KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_126373Help
Entry
PHYPADRAFT_126373 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PHYPADRAFT_126373
Protein kinases [BR:ppp01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PHYPADRAFT_126373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 338 aa AA seqDB search
SDFKLGPILGTGSFGRVHVAHHTPTGQVCATKSLSKASIVKSKQVLHVKQEKSILAKISH
PFVVNLLGCCQDDQCVHLVIEYVCGGEFFTYLRSTGRFDEATTRFYASQVLCAFEYLHSM
DIIYRDLKPENLLLDAKGNLKVTDFGFAKQIDRRTYTLCGTPDYLAPEIILNKGHGKPVD
WWTFGVLIYEMLAGYPPFYDDDPVGTYQKILSGKIQFPGHFSKSAKDLLRRLLVADLTKR
IGCLKGGVKEIKTHAWFQTVDWDAVVSKKDTPPIRPKVSVRACTSLTFDSFTCISYLNKV
IEFPQSNNNLTLPQSPIYQSSITRKQSAHVSRFQLFHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
tcggatttcaagttgggtcctattttgggaacgggaagctttggtcgagttcacgttgcg
catcacactccgactggtcaagtttgcgccaccaaatctttatctaaggcctcaattgtt
aaatcaaaacaggtgctgcacgtgaagcaagaaaaatcaatcttagcgaagatatcacac
ccttttgtggttaatctgcttggatgttgccaagatgatcagtgtgtacatcttgttata
gaatatgtttgtgggggcgagtttttcacctacctacgcagcactgggcgttttgatgag
gcgaccactagattttatgcctcacaagtattatgcgcatttgagtatctgcatagtatg
gatatcatataccgagatcttaagcctgagaacctgctgcttgatgcgaaaggaaatctc
aaggtcactgattttgggttcgctaagcagatcgaccgaagaacctacactttgtgtggt
acacctgattaccttgctcctgagattattctgaataagggccacggcaagcctgttgat
tggtggacttttggagttttgatatacgagatgttagctggatatcctcctttctatgat
gatgatcctgtcggcacataccaaaaaatactaagtggtaaaatacaatttccaggacac
ttttcaaagagtgcaaaagaccttttaagaagactcctagtagcagacttgacaaagcga
ataggatgcttaaaaggaggagtgaaggaaatcaaaacacatgcatggtttcaaactgtc
gactgggatgctgttgtttccaaaaaagacactcctcccattcgacccaaagtctcagta
cgtgcctgcacttctcttacatttgatagtttcacctgcatttcatatttaaacaaggtt
atcgaatttcctcaatctaacaataatcttacacttcctcaaagtccaatttatcaatcc
tcaataacaagaaaacaatcagcacatgtctctcggttccaattgtttcatctctag

DBGET integrated database retrieval system