KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_126815Help
Entry
PHYPADRAFT_126815 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_126815
   01230 Biosynthesis of amino acids
    PHYPADRAFT_126815
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYPADRAFT_126815
   00051 Fructose and mannose metabolism
    PHYPADRAFT_126815
   00562 Inositol phosphate metabolism
    PHYPADRAFT_126815
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHYPADRAFT_126815
Enzymes [BR:ppp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PHYPADRAFT_126815
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PHYPADRAFT_126815
  Exosomal proteins of bladder cancer cells
   PHYPADRAFT_126815
  Exosomal proteins of melanoma cells
   PHYPADRAFT_126815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 269 aa AA seqDB search
MQSEGKGHRGVVTMTGAGKFFVGGNWKCNGTTESIKKLVEDLNSAQIEDDVDVVVAPPFL
YISQVVGSLTDRIEVSAQNSWVGKGGAFTGEISADQLVDVGVKWVIQGHSERRHVIGESN
STVGKKSAYALSKGLGLIACVGELLEEREAGRTTDVVFEQLQAYADEISDWSKVVIAYEP
VWAIGTGKVASPQQAQEVHSAIRSWLSDKISPEVSSATRIIYGGSVNGANSAELAKQEDI
DGFLVGGASLKGPEFATICNAVTAKKVSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtgaggggaaggggcacagaggtgtcgtcaccatgactggggccgggaagttt
ttcgttggcgggaactggaagtgcaatggcacaactgagtcgatcaagaagctcgtggag
gatttgaacagtgcccaaattgaggacgacgttgatgtcgtcgtcgctcccccgtttttg
tatatcagccaggtggtcgggtctttgacggaccgcattgaggtctccgctcagaactct
tgggtcggcaagggaggagccttcactggtgagattagcgccgaccagctggtcgatgtc
ggtgtgaagtgggtaattcagggccactctgagcgccgacacgtcattggcgagtcgaat
tcaaccgttgggaagaagagcgcgtacgcattgtccaaaggcttgggattgattgcttgc
gttggagagttgctcgaggagcgcgaagccggccgtaccacagatgttgtgtttgagcag
ctgcaagcatatgccgatgagatctcagattggtcgaaggtggtgattgcctacgaacca
gtgtgggccattggaactggcaaagttgcctctcctcagcaagcgcaggaggtgcacagc
gccattcgatcgtggttgagtgacaagatctcgccagaggtgtcctctgcgactcgcatt
atttacggtggttctgtgaacggagctaacagtgccgagcttgccaagcaagaagatatt
gatggtttccttgtcggtggagcctcattgaaaggacctgagttcgccacaatctgcaat
gctgtcaccgcaaagaaagtttctgcataa

DBGET integrated database retrieval system