KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_127293Help
Entry
PHYPADRAFT_127293 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PHYPADRAFT_127293
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PHYPADRAFT_127293
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PHYPADRAFT_127293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 527 aa AA seqDB search
MKGEKRPDTATYVAAIDQGTTSTRFIVYDTAAKVVVSHQLEFTQIYPQAGWVEHDPMEIL
DTVRKAMEGALAKGKEKGLDILDNLKAIGITNQRETTVIWSRSTGKPYYNAVVWMDSRTS
SICRHLEKQHPEGGRRFVSTCGLPIHPYFSATKILWLMEHVPEVKAGVESGDALFGTIDT
WLIWNLTGGLNAEEPVHVTDCTNAARTMLMDLTTLQWHEPTLKDLGIPRSILPKIISNVE
LIGKVSEDWPFAGIQLAGCLGDQHAATLGQQCKAGEAKSTYGTGCFIVLNTGEQIVPSNH
GLLTTISYKLGPDAPTNYALEGSIAIGGAAVQWLRDNLGIIKSSSEIESLAKTVNNTGGV
YFVPAFSGLFAPWWRDDARGVLVGITRYTNKAHIARATLESMCYQVKEVLTSMKADAGNI
EATVGGEFLLRVDGGATVNNLLMQLQADLLGSPVVRPVDIETTALGAAYAAGLAVGVWTK
EQIIEQGAVQEAPTVFHSQITDDERNKRCLSWNKAVERSFGLAELDF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggagaagagaccagacacagcgacgtatgtagctgctattgatcagggtacc
accagcactcgttttattgtgtatgatactgccgccaaggttgtggtatcgcatcagctg
gagtttacgcagatctatccacaggcaggatgggtagaacacgacccgatggaaatcttg
gatacagttcgaaaagccatggaaggtgcacttgcaaaaggcaaagagaaaggactagat
atccttgataacttgaaggcaatagggatcactaatcaaagagagaccacagttatttgg
agtaggagcacgggaaagccatactacaacgcagtagtgtggatggacagccgcacaagt
tccatatgcaggcatttggagaaacagcatcccgaaggtggtcgcagatttgtgagcacc
tgtggtcttcctatccatccttatttcagcgccaccaagattctttggctcatggaacat
gtgccagaggtgaaagctggggtagaaagtggggatgctctatttgggactatcgacaca
tggctcatctggaatttaacaggcggattgaacgctgaagaacctgtgcatgtaaccgac
tgcacaaatgctgctcgtactatgctcatggatttgaccacgttacagtggcatgagcct
acactaaaggatctgggcattcctcgttccatattgcccaaaatcattagcaatgtggaa
ctgattgggaaggtatctgaggactggccgttcgcaggtattcagttggctggttgttta
ggagaccagcacgcagccactcttggacaacagtgtaaagcaggagaggccaagagcaca
tacggaacagggtgttttattgtacttaatacaggagaacaaattgttccatcgaatcat
ggattgttgacaacaatttcatacaagcttggaccagacgctcctaccaactatgcactt
gaaggctctattgcaattggaggggcagccgttcaatggttaagggacaatttgggcatc
ataaaaagctcaagtgagatcgagagtctagcaaagaccgttaataacacaggaggagtt
tactttgtacctgcatttagtgggctttttgctccttggtggagagacgatgcacgtgga
gtgttggttggcatcacgaggtacacaaacaaggcccacatcgctcgggccacattagag
agcatgtgctaccaggttaaggaggttctgacatcaatgaaagcagatgcgggtaacatt
gaggctactgttggcggggaattcttgctgagagtggatggtggtgcaactgttaataat
ttgcttatgcagcttcaggctgatttacttggaagtccagtggttagaccagttgacatt
gagactacagctttaggagcagcttatgctgctggtcttgctgtgggagtatggaccaag
gaacagattattgaacaaggtgctgttcaggaagcaccaactgtctttcactctcaaata
acagatgacgagcgtaacaagagatgcctgagttggaacaaggcagttgaaagatccttt
ggcctcgcagagcttgatttctga

DBGET integrated database retrieval system