KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_128384Help
Entry
PHYPADRAFT_128384 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHYPADRAFT_128384
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PHYPADRAFT_128384
   00603 Glycosphingolipid biosynthesis - globo series
    PHYPADRAFT_128384
   00604 Glycosphingolipid biosynthesis - ganglio series
    PHYPADRAFT_128384
   00511 Other glycan degradation
    PHYPADRAFT_128384
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PHYPADRAFT_128384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 426 aa AA seqDB search
QLQYGVDESYMLDVRDSSDSNVAYLEALTVYGALRGLETFSQLTSYNFTSKSVQIRRTPC
FIKDFPRFPYRGLLIDTSRHYQPVTSIKRVLDSMAYSKLNVLHWHIVDEQSFPIEIPSYP
LLWNGAYSYAERYTMDDAREIVEYARLRGINVMPELDVPGHAASWGVGYPELWPTSKCIE
PLDVSSNFTFDVINGIIEDFRTVFPFKFAHLGGDEVDTGCWERTSHIQNWLNVRNITAKD
AYADFVVRAQDIAIKHGYVPVNWEETFHTFSSRLKKETVVHNWFQSGTCAQAVKKGFSCI
LSDQSSWYLDHLDATWDKFYETEPFSNIENKDEQDLMLGGEVCMWGETADESNILQTIWP
RAAAAAERLWSTLEYTKVGHTQAVSRFQHFRCLLNRREIPAAPIFYGSRFAYGRSSPYGP
GSCFKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
cagcttcaatacggagtggacgagtcctacatgctggacgttcgtgattcatcagattcc
aacgttgcttaccttgaagcgctgactgtttacggagctctacgtggtcttgagacgttt
agtcagctgacgtcatacaattttacatcgaaatcggtgcaaatacgaaggactccatgc
ttcatcaaagactttcccagatttccataccgtgggcttcttatagatacctctcgccat
taccaaccagttacgtctataaaacgtgtccttgactcgatggcatattccaaacttaat
gttctgcattggcatattgttgacgagcaatcattcccaattgaaattccctcataccct
ttgctttggaatggtgcttactcgtatgctgagcgctacaccatggatgatgctcgtgaa
attgtggaatatgcacgtttgagaggcattaacgttatgccggagttggatgtgcctggt
cacgcagcgtcttggggtgtgggctacccagaactttggcccacatcaaagtgcattgag
ccgttggacgtaagcagtaattttacattcgatgtgatcaacggcataatcgaagatttc
aggacagtctttccatttaaatttgcccacttgggtggtgatgaagttgacacaggttgc
tgggagcgaacttcccacattcagaactggttgaacgtcaggaacatcaccgcgaaagat
gcatatgctgactttgtagtccgtgctcaggatatcgcaatcaagcatggctatgtgcct
gtgaactgggaagaaacgtttcatacattttcatcgcgtctcaagaaggagacggttgtc
cacaattggtttcagagtggaacgtgtgcacaagctgtgaaaaagggatttagctgcata
ttaagcgatcaaagttcttggtacttggaccatttagacgctacctgggacaaattctac
gagactgaacctttctccaacatagaaaacaaggacgagcaggatcttatgttgggaggg
gaggtgtgcatgtggggcgaaacagctgatgaatcgaatatcttgcaaactatatggcca
cgtgctgcagcagctgcagagcgtctttggagcacgcttgagtatacgaaagtagggcat
acccaagctgtgagtaggtttcagcattttcggtgtcttctgaatagacgtgaaattcca
gctgctcctatattttacggtagcagatttgcatatggacgaagttcaccgtatggcccc
ggatcgtgtttcaaacagtga

DBGET integrated database retrieval system