KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_128953Help
Entry
PHYPADRAFT_128953 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PHYPADRAFT_128953
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PHYPADRAFT_128953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 422 aa AA seqDB search
MGAEVPPAWPGRAVAEEVKIRNGPKPISLIGSTGSIGTQTLDIVAENPDRFKVVALAAGS
NITLLAEQIKVFKPSLVAVKEASSVPALREALAGLEKLPEIMVGDEGIVEVARHPEAVTV
VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKKHGIKILPADSEHSAIF
QCIQGLPESGLRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGRKITVDSATLMN
KGLEVIEAHYLFGADYDDIDIVVHPQSIIHSMVETQDSSVIAQLGWPDMRLPILYTMSWP
ERIPCSEKTWPRLDFFKMGNLTFMKPDHAKYPSMALSYSAGRAGGTMTGVLSAANEKAVE
LFLEERIGYLDIVKLIEKTCAKHREELVESPSLEEILHFDGWARDYTAELVESGSFLAAV
IV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagaagtgcctccagcttggcctgggagggctgtcgcggaggaagtcaagatc
agaaatggccccaaacctatttccctcattggatcgaccggttctattggcacacagacg
ctggacattgttgccgagaatccggacagattcaaggtcgtggctttggctgctggctcc
aatatcactcttttggctgaacagattaaggtgttcaaacccagccttgtggcagtcaag
gaggcctcatcagtgcctgcactaagagaagctcttgctggcttggaaaagcttccagag
atcatggttggcgatgaaggcattgtggaggtggcgagacatccagaagccgttactgtt
gttacaggaattgttggttgcgcaggattgaagcccacagttgctgctattgaagctggt
aaagatattgccttggccaacaaagagactttgattgctggaggtccatatgtgttacct
ctggctaagaagcatggcattaaaatcttgccagctgattctgagcactcggccatcttt
cagtgtatccaaggtcttcctgaaagtggattgaggcgtattatacttacggcgtccgga
ggtgcattcagagattggccagtggagaagttaaaagatgttaaagtagcagatgctttg
aagcatcccaactggagcatgggccgcaaaattacggttgattctgctacgctcatgaac
aagggtctggaagtgattgaagcccattatctcttcggagctgattacgatgatattgat
attgttgttcatccccaatcaattattcattccatggtggagacgcaggactcctcagtc
attgcccaattaggctggccagacatgcggctacccattctttacaccatgtcgtggcca
gagcgtattccctgttcagagaagacatggcctcgtttggactttttcaaaatgggaaat
cttactttcatgaagccagaccacgccaaatacccctccatggcactctcttacagtgcc
ggtcgggctggtgggacgatgaccggtgtgctaagtgccgcaaatgaaaaggctgttgag
cttttccttgaggagaggattggctacttggacatcgtgaaattgatcgaaaaaacatgt
gcaaagcacagagaggaactggttgaaagtccttcattggaggaaattcttcatttcgat
ggatgggcacgagactacacagccgagttggtagaatctggctcgttcctggcagcagtc
attgtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system