KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_129823Help
Entry
PHYPADRAFT_129823 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ppp01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ppp00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 270 aa AA seqDB search
GIGDECRNQGLYEFTNFLINESGAFGFCIEIGNGASDSFFMRLDKQADLVCEQVKKIPEL
RGGYNVGNVVARAVIEFCDGGPPVHNFVSLGGPHAGTASIPGCSIMSLCKLADALIRLGV
YSSFVQNHLAPSGYVKIPNDLAAYYKGSMFLPKLNNEIASTRNETYKKRFESINHLVLIM
FQEDAILVPPQTAWFGYYGENDFTTVLPPERTDLYKEDWIGLRTLDEAGRVTYIAFPGDH
LSINDVQLKKFVVPYLRSSPIAPSIDWSSY
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ggcattggagatgaatgtaggaaccaagggctgtacgaatttactaattttctcatcaac
gagtctggagcttttggattttgcatagagataggcaatggagcaagtgactcgttcttt
atgcgccttgacaagcaggctgaccttgtgtgcgagcaggtgaaaaagattccagaactg
agaggcggctacaacgttggaaatgtcgtggctcgtgctgtgattgaattttgtgacggt
ggaccacctgtccacaacttcgtatccttgggaggacctcatgcaggaactgcatcaata
ccagggtgttcgatcatgtccctttgtaaattggcggacgcactaattagacttggtgta
tattcatcatttgtacagaaccaccttgctccgagtggctacgtgaaaattcctaacgat
ttggctgcctattataagggttcaatgttcttaccgaaactaaacaatgagatagcttct
actcggaacgaaacctacaaaaagagattcgaaagtattaatcacctggtgttgattatg
ttccaggaggatgctatcttagttcctcctcaaacagcttggtttggttactatggtgag
aatgatttcactactgtactacctcctgaaaggacggatctatacaaggaggactggatt
ggacttagaaccttggacgaagcgggccgagtgacatacattgcttttcctggtgaccac
ttaagtataaacgacgtccagcttaaaaagtttgttgttccgtaccttaggagctcccct
attgctcctagtattgactggtcatcgtattga

DBGET integrated database retrieval system