KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_130367Help
Entry
PHYPADRAFT_130367 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_130367
   01230 Biosynthesis of amino acids
    PHYPADRAFT_130367
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYPADRAFT_130367
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHYPADRAFT_130367
Enzymes [BR:ppp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PHYPADRAFT_130367
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PHYPADRAFT_130367
  Exosomal proteins of melanoma cells
   PHYPADRAFT_130367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 253 aa AA seqDB search
MCLSTWLFVLVAGESALILIRHGESLWNSKNLFTGCVDVPLSQKGVEEAIEAGKCISELP
VDMIFTSALIRAQMTAMLAMTQHHRQKVPVILHNESERAEAWSRIYSDTDDVIPVVTAWQ
LNERMYGELQGLNKAETAEKFGTEKVKEWRRSYDIPPPNGESLEMCAERAVKYFVDNVVP
ELESGKNIMIAAHGNSLRAIIMYLDKLTSKEVIELELSTGIPMLYTLQDSKFLRRGSPVG
PTVQGVYALTQVS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttgagcacttggctgtttgtgttggttgcaggggagtcggcactgattctcatt
cgccatggagaatcgctatggaactcgaagaatctcttcacgggatgtgtggacgtccct
ctgtctcagaagggcgtggaagaagcgatcgaagcaggcaagtgcattagcgagctcccc
gtggatatgatcttcacctctgcgctgattcgggctcagatgactgctatgctcgccatg
acgcagcaccatcgccagaaggtgccagtgattcttcacaacgaaagtgagagggcagaa
gcgtggagtagaatatacagcgatacagacgatgtcatccccgtggtcaccgcatggcag
cttaatgagcgcatgtacggtgaattacaaggattgaacaaggcagaaacagctgagaaa
ttcggcactgagaaagtcaaagagtggcgccgaagctatgatatccctccacccaatggg
gagagcctcgagatgtgtgcagagcgcgccgtcaagtacttcgtggacaacgtggtccca
gagctggaatctgggaagaacataatgatcgcagcgcacggcaattccttgcgcgccatc
atcatgtacttagacaagctcacatccaaggaagtgatcgagctcgagctctcaaccggc
attcccatgctctacactttgcaagactcaaaattcctccggcgaggaagtccagtggga
ccaacagttcagggtgtctacgcgttgacacaggtcagctaa

DBGET integrated database retrieval system