KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_130814Help
Entry
PHYPADRAFT_130814 CDS       T01041                                 

Gene name
HAG1501
Definition
histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHYPADRAFT_130814 (HAG1501)
Transcription machinery [BR:ppp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PHYPADRAFT_130814 (HAG1501)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 414 aa AA seqDB search
SRVKVEPSVDGARESGAQLPAVTPSPNLAGASGNSVDVKPSVADTIQTSGAYCSREENLK
KEEDAGRLKFICLSNDGEDQHMIWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSMMIIK
NNNVVGGITYRPYLSQRFGEIAFCAITADEQVKGYGTRLMNHLKQYARVSDGLTHFLTYA
DNNAVGYFTKQGFTKEIEMEKERWHGYIKDYDGGTLMECRIDPKLPYIDLPAMIRSQRQA
SAIDEKIRELSNCHLVYQGLDLPKKEAGVLKRPLRIEDIPGLKEAGWVPDQPPHSRFRLI
NNPSDGPPSRQALHNFMRSLVKAVTEHADAWPFKEPVDAREVPDYYDIIKDPIDLKTISK
RVESEQYYITLEMFASDMKRMFNNARTYNSPETIYYKCTNRYALPIPLLCCLSF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
tcccgcgtgaaggttgaaccatcagtggatggagctcgagagtccggagcacagttacca
gccgtgaccccaagtcccaatctagctggtgccagtggcaactctgttgacgtcaagcct
agcgtggcagatacaattcagaccagtggtgcttattgttctcgcgaagaaaatcttaag
aaagaggaagatgctggtcgccttaagtttatatgccttagcaatgacggcgaagatcag
catatgatttggcttattggtttgaaaaacatctttgcaaggcaacttcccaacatgcct
aaagagtacatagtgcgtcttgtgatggacagaagccacaaatctatgatgatcatcaaa
aacaacaacgtggtgggaggtattacatacagaccatatcttagccaaagatttggggag
attgccttttgcgctattactgccgatgaacaggtgaaagggtatggtacacgcttgatg
aatcacttgaagcagtatgcgcgtgtttctgatggtcttacacattttcttacgtatgcg
gataacaatgctgttggttacttcaccaagcagggattcacaaaagaaattgaaatggag
aaggagagatggcatggttatatcaaagattatgatggagggaccttgatggagtgccgc
attgatccaaagttaccctatatcgatctccctgctatgattagaagtcaaaggcaggca
tcggctattgatgagaagatccgagaactttcaaactgtcatctggtctatcaagggctt
gatctacctaagaaggaagctggagtcctcaagcgacccttacgaatagaagatattccg
ggtcttaaagaggcagggtgggtacctgatcaaccacctcattctcggtttaggctcatc
aacaacccctcagatggtccaccttcacgtcaagctttgcataattttatgcgatcattg
gttaaggctgtaactgagcacgcagatgcgtggcctttcaaagaaccagtcgatgcacgg
gaggttcctgattactatgacatcattaaggatcccatcgatttgaagaccatctctaaa
cgcgtggaaagtgaacaatattatataactctagagatgtttgcttccgatatgaagcgt
atgttcaataacgctcgcacgtacaactctccagaaactatctattacaagtgtaccaac
aggtatgcccttcctattccattgttatgctgtctttcattttaa

DBGET integrated database retrieval system