KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_132301Help
Entry
PHYPADRAFT_132301 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PHYPADRAFT_132301
   00500 Starch and sucrose metabolism
    PHYPADRAFT_132301
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PHYPADRAFT_132301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 532 aa AA seqDB search
MKKAKEKVKNWDPTAVNSACQSTRYPDTCNETFTGDYPRDTNGVMRHSVQSSEKGVNDTL
GFMSEFDSSDPVISGAVEVCNEVLVSAREELEAASTALETKDTLGVDTLKDIQAWVSAAM
ELHTTCIDAFMEVNNVTGSALAKKSAKTDELLSNSLAFINALAHLPEGFNFTLPNVTLPN
IPGFGNRKLLSVEELEMDEGFPGWMDVETRRHLLQAPPKYDVVVAQDGSGNFRTIQAAVD
AHKTNTKRLVIYIKAGIYNEQVIVPKKAKFLTLIGDGDRTVLTGDRNVALMKGMTTFKSA
TLIVSGAGFVGRSFRVQNTAGAEGHQAVAFRGSADNIAFYQVTFDSFQDTLYCHSFRQFY
RDCTVFGTVDFIFGNAAAAFQNCKIIAKKSTILGQQNTYTAQGRTDPNQATGLSFQNCVI
DGTSDLMASVAQYKSYLGRPWKAYSVCVIMKSEIKGHVDPTGWLPWNTTNFGLYTSYFAE
YKNFGLGSAIDNRVQWSHQVGNDKQANYYQANNFIQASEWVSGLDVPLTTAL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggccaaagagaaagtgaagaactgggaccctactgcggtgaacagtgcttgc
cagtccacacgatacccggacacttgcaatgaaacattcacaggggactacccgcgcgac
acgaacggcgtcatgcgacattcagtgcaaagctctgagaagggagtgaacgacactttg
ggcttcatgagtgaattcgactcgtccgacccggtaatctcaggcgcggtggaggtttgc
aatgaggtactagtcagcgcccgggaggagctcgaagcggcctccacggcgctggagacg
aaggataccttgggagttgacactctgaaggatatccaggcgtgggtgagcgctgcgatg
gagctccatacgacttgtatagatgcatttatggaggtgaataatgtaacggggtcggca
cttgcaaagaagtcagccaaaacggacgagcttctgagcaattctctggcattcatcaac
gcgctggcgcacttgccggaggggtttaacttcacgttgccaaatgtgacacttcccaat
atccctggcttcggcaaccggaagttactttcagtggaagagcttgaaatggacgaggga
tttcctgggtggatggatgttgagacaagacgacatttgcttcaagcaccaccaaagtat
gatgttgtggtggcgcaggatgggtcagggaacttcaggaccatccaggcggcggtggat
gcgcacaagaccaacaccaagcgtttggtgatttacatcaaggcggggatctacaatgag
caggtcatcgtgcccaagaaggccaagtttctgacgcttattggagatggtgaccggact
gttcttacaggagacagaaacgttgcgctgatgaaggggatgaccactttcaaatctgca
actctcattgtctccggtgctggatttgtcgggcggtcgttccgagtgcaaaacactgcg
ggagccgagggacaccaagctgtggctttccggggatccgctgataacatcgcgttttac
caggtgacttttgacagcttccaggatacgctatactgccattcgttccgccagttctac
cgggactgcacggtgtttggtaccgtggacttcatttttggcaacgccgcagccgcgttt
cagaactgcaaaattatcgcaaagaagagtacgattctgggccagcagaacacctacacg
gcgcagggcaggactgatccgaaccaggcaacagggctcagctttcagaactgtgtcatt
gacgggacgtctgatttgatggctagtgtggcgcagtacaagtcttacttgggccggccg
tggaaggcttattcagtgtgtgtgatcatgaaatcagagatcaaggggcatgttgatcct
acgggatggttgccgtggaacacgactaactttggcctttacacttcatactttgctgag
tacaagaactttggacttgggtcggcgatcgacaatagagtgcagtggtcgcaccaggtg
gggaatgacaaacaggcaaattattaccaggccaacaacttcattcaagccagtgagtgg
gttagtggactcgatgttccgctcaccacggcattgtga

DBGET integrated database retrieval system