KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_132891Help
Entry
PHYPADRAFT_132891 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    PHYPADRAFT_132891
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PHYPADRAFT_132891
Protein kinases [BR:ppp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PHYPADRAFT_132891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 370 aa AA seqDB search
MECESSIENVPNLLQGMRYTQYYVRDDKFEVYDKYVMIGPIGHGAYGDVCAFTNKETGEK
VAIKKIGNAFQNHTTARRTLREILLLRHTEHDNIIPIRDIIVPANIEDFEDAYIANELMD
TDLHQIVRSTKLDEYHCQFLLYQLLRGLKYIHSANILHRDLKPSNLLINCNDCLLKICDF
GLARTSAEDDFLTEYVVTRPYRAPELLLGSRMYTAAVDMWSVGCIFMEMLTGQPLFPIRS
RQEHPVNHLKLITELLGTPDASDLSFLQNPDARQRIQMALIGQERKPLFSRFPQTSAAAC
DLAEKMLRFNPSNRITAEDALAHPYLSALHDVSDEPTCHLLFDFDAYLPNLSVDHVKTLI
WREATLINAQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtgagtcatctattgaaaatgtgccaaaccttttacaaggaatgaggtacaca
cagtactatgtgagggacgataagtttgaagtatatgataagtacgtcatgattggtcct
attggccatggagcatatggcgatgtgtgtgctttcacaaacaaggagactggggagaag
gtagccataaagaagattggtaatgcctttcagaaccacacaacagcgaggcgcactctt
agagagattttgttgctccggcacactgagcatgacaacatcattcctatcagagatatt
attgtgcctgcaaacattgaagattttgaggatgcttatattgcaaatgagctcatggat
acagaccttcatcagatagtgagatcaactaagctcgacgaataccactgccagttcctg
ctttatcagcttctgaggggcctcaagtacattcattcagctaatatattacaccgcgat
ctgaagcctagtaatcttctcatcaactgcaacgattgtctactcaagatctgtgatttt
ggcttggctcgaacctctgcagaggatgattttcttacggagtacgttgttactcgacct
tatcgagctccggagcttttgcttgggagccgaatgtacacagctgctgttgatatgtgg
tcagtgggctgtatctttatggagatgctcacaggtcaacctttgttcccaatccggtca
agacaagagcatcccgtgaatcacttgaaacttatcaccgagctactagggactcctgat
gcttcggacttgtcgttcctgcagaatccggatgctcggcaaaggatacaaatggccttg
ataggtcaggaaagaaagcccttgttttcgaggttcccacaaacttctgctgcagcttgc
gacttagccgagaagatgctgagattcaacccctccaacaggataactgcggaagatgct
ttggctcatccttatctgtcagcacttcacgacgtcagtgatgagccaacctgtcatctt
ctgttcgacttcgacgcctacctgcccaatctctctgtcgatcatgttaaaactctcatt
tggcgagaggctactcttataaacgctcagtaa

DBGET integrated database retrieval system