KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_133245Help
Entry
PHYPADRAFT_133245 CDS       T01041                                 

Gene name
PLC3
Definition
PLC3 phospholipase C protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PHYPADRAFT_133245 (PLC3)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    PHYPADRAFT_133245 (PLC3)
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     PHYPADRAFT_133245 (PLC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 602 aa AA seqDB search
MCSIACCRSGTPKGDPEQDLVGEVFTIYSENERMSAEGLLKFLHTEQGDVDFTLDDAKQI
MERIRKDWKKSFGLASINSDLSKEAFRKYLMNPDLNGVLHNVVHQDMTQPMSHYFIFTGH
NSYLTGNQLSSDSSDTPIAAALRRGVRVVELDLWPDDKGGMKVTHGNTLTNPVSFQKCVT
AIKNNAFFTSEYPVCVTIEDHLTSELQGHAAEILEQILGDALYYPPTTDALVEFPSPESL
KRKIIISTKPPKEYLEACSTQKLAMENRNLVEELEKEDKLEQTTFAPLEENHILGENTPS
LRKEVESNDGNDNPKHFKYARLITIRLAKHAKGTSMEHRLQVDESVKRISLSESKLEKVV
EKWPEALVKFTQKNILRVYPAANRVNSSNFCPTLAWNYGAQMVAQNMQAKLFHGYGKELW
QAFGKFKGNGGCGYVLKPQYLLENLPSGVPFNPTSPRNTTLILKIKVMTTLGWDKAFSKR
HFDLFSPPDFFTRVIVVGVPADEAKWKTSVVDNSWAPHWNEDHEFALKCPELALLRIEVR
DHDDDSKDEFEGQTCLPIHEVRDGYRCMQMYDKKGNVLKGVLMLFHFQKCKCTFQDTAPI
SS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtgttccatagcatgttgtcgaagtggaaccccgaaaggggatccggagcaagacctg
gtgggggaggtgttcacaatatacagcgagaatgagagaatgagtgcggaggggttgctg
aaattcttgcatacagagcaaggggatgtcgacttcacccttgatgacgccaagcagatc
atggagcgcattcgcaaggactggaagaaatccttcggactcgcctctatcaactcagac
ttgtcgaaggaggcttttcggaagtacttgatgaatcccgacttgaatggcgtcttacac
aacgttgttcaccaagacatgacgcagccgatgtcgcactacttcatattcacgggccat
aactcgtacctgaccggcaaccagctgagcagcgacagcagcgacacacccatcgctgcg
gcactgcggcgcggcgtgcgggttgtggaattggacttgtggcctgatgacaaaggcggc
atgaaggtcacacacggaaacacacttaccaatccggtgtcgttccaaaagtgtgtcaca
gccatcaagaataacgccttcttcacctcggagtacccagtttgcgttactattgaggat
catcttacaagcgaattacagggccatgctgcagagattttagagcaaattctcggagac
gccctgtattatccacccacaactgatgcattagtggagtttccttcaccggagtcactg
aagaggaagatcataatctccaccaaaccgccgaaggagtatctcgaagcatgttccacg
cagaaattggccatggagaacaggaatctggtggaggagctcgagaaggaagacaaattg
gagcagaccacattcgctccccttgaagagaaccacatcctgggagaaaatacaccatcg
ctgcgtaaggaagtcgagagcaacgatggcaatgacaaccctaaacatttcaagtatgcc
cggctcatcacaatccggctagcaaagcacgcaaaggggacatcgatggagcatcgactg
caagtcgatgaatcagtgaaacggatcagtctgtcggaatcgaagctggaaaaagtggtg
gaaaagtggcccgaagctctggtcaaattcacgcagaagaacattttacgtgtgtatcct
gctgctaatcgtgtaaactcctccaacttctgccctactctggcttggaactacggagct
caaatggtggctcaaaacatgcaggcaaagctctttcatggctatggtaaagagctttgg
caggcatttggcaagttcaagggaaatgggggatgtgggtatgttttgaagccacagtat
ctgttggaaaacttgccttctggtgtgcctttcaaccccacatcacccagaaacacaacc
ctaattctcaagattaaagttatgactaccttgggatgggacaaggccttttccaaacgc
cattttgacctattctcacctccagatttcttcactagggtgattgtggtgggagtgcct
gctgacgaggccaagtggaagacatctgtggtggacaattcatgggcaccccattggaat
gaggaccatgagtttgccctaaaatgccctgagctcgcactacttcgcatcgaggtccga
gaccatgatgatgatagcaaagatgagtttgaagggcagacatgccttcccatccatgaa
gtccgggatgggtatcggtgcatgcaaatgtacgacaagaagggcaatgtactgaaaggc
gtgctgatgttgtttcattttcaaaagtgcaaatgcacctttcaagacacagctcctata
tcctcttaa

DBGET integrated database retrieval system