KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_134384Help
Entry
PHYPADRAFT_134384 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PHYPADRAFT_134384
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PHYPADRAFT_134384
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PHYPADRAFT_134384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 195 aa AA seqDB search
MQVQRPPLEAWYMNDSEEDQRLPHHRNPPEYVTLEKLAALGVIHWVLDADNHETDPELSI
IRKDRGYNYTDVITVCPEMLPSYEAKIKSFYEEHIHMDEEIRYCLDGSGYFDVRDPEDHW
IRIWVRKGDMIVLPAGCYHRFTLDEHNYIMAMRLFVGEPIWTPYNRPQDEHPVRKGYVHQ
FLQPELLDVDMSISA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgcagagaccacctttggaagcatggtacatgaatgattcagaggaagaccaa
cgactgcctcaccaccgcaacccacctgaatatgtgactctggaaaagcttgccgccctc
ggtgtgatacactgggtgcttgatgctgataaccatgaaactgatcctgaattgagcata
atccgcaaagatagaggatacaactatacggacgttattaccgtgtgtcctgaaatgctt
cccagttatgaggcgaaaatcaagagtttctacgaggagcacatccacatggacgaggag
atccgttactgcttggacggcagtggttacttcgacgtccgggacccagaagaccattgg
atccggatctgggtgcggaagggagacatgatagtgctacctgcggggtgctaccatcgt
ttcacgctggatgagcacaattacataatggcgatgaggctatttgtcggtgagcctatc
tggaccccatacaaccgaccacaagacgagcatcccgtgaggaagggttacgtccaccaa
tttctccagccagagttactggacgtggacatgtcaatctcagcgtag

DBGET integrated database retrieval system