KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_135228Help
Entry
PHYPADRAFT_135228 CDS       T01041                                 

Definition
hypothetical protein
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 528 aa AA seqDB search
MLVLALRDVQSLKLKIELRGLAKSVTIQNLVCAPFLLVFILTAVESDQLWHTRSLQTFLW
ERLWCCSLFKVLVYFGGIVLATTLYFLYHPRRVYMLDFACHKPHEKNAISKQGLLNYAGS
SGLLSDKSLDFMRKILERSGLGDSTYVPAAITSTPADRSMVAAREEAATNMFCSLDELFA
KTGVNSKDVKILVVNSSVFCPTPSLSAMVVNRYKMRSDIKSINVSGMGCSAGLIAIDLAK
DLLHGCYRNSYAIVCSQEILCRNSYCGNDRAKLVSNCLFRMGGAAVLLSNRSRDRWRAKY
ELMHTVRTHTGPNDKCYQCVVEEEDEEGRIGVTLSKDLMSVAGEALKINISTLGPLVLPW
MEQLQFIISMVGRKVFKTNTKPYIPDFKTAFEHFCIHAGGRAVLDEVEKNLHLTEWHMEP
SRMTLYRFGNTSSSSLWYELAYCEAKGRVKKGDRIWQIAFGSGFKCNSAVWRALRTIAPP
ALNPWDGIIDQYPVKGVSVPCELVFPLQSAASAGTSERQSVGRDLSNP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctagtattagcgctgcgtgatgtccagtcattgaagttgaagattgaactgcgagga
ttggccaagtctgtcacaattcaaaatttagtttgtgcgccgttcttactggtgttcata
ctcactgcggtcgaaagcgatcaactctggcacacgaggtcgcttcaaacattcctgtgg
gagcgtctgtggtgttgtagcttgttcaaggttttagtttactttggaggtatagtcttg
gctacgaccttgtactttctctaccatcctcgtcgcgtctatatgctggactttgcatgc
cacaagccgcatgagaaaaacgccatcagcaagcaaggacttctgaattatgccggttcc
agtggtttgcttagtgacaagagtttggacttcatgagaaagatactagagcgatcgggt
ctgggagattcaacctacgtgccggcagcgatcacgagcacaccggctgaccgctcaatg
gtggcagctcgagaggaagctgcgaccaacatgttttgctctctcgacgagctatttgca
aaaactggcgtgaattccaaagacgtcaagattttggtagtcaatagcagcgtgttttgt
ccaactccatccctttctgctatggtcgtgaaccggtataagatgcgcagcgacatcaag
agcatcaacgtctcaggcatgggttgcagtgcaggtctgatagccattgacctggccaag
gatcttctccacggctgctaccgaaactcttacgctatcgtttgcagccaagagattttg
tgtagaaattcctactgtgggaacgaccgggcgaaactggtgtcgaattgcttgtttcgc
atggggggggctgccgtgttattgtcgaacaggagccgcgaccggtggcgagccaagtac
gagctcatgcacaccgtgcgaacccacactggtcctaatgacaaatgctaccaatgtgtt
gttgaggaagaagacgaagagggcagaattggagttacattgtcaaaagatcttatgagc
gttgctggagaggctctgaaaatcaatatttcaacactcggaccgttggtgcttccatgg
atggagcagctgcaattcatcatctcgatggtaggtcgcaaggtcttcaagacgaatact
aagccctacattccagatttcaagactgccttcgagcacttctgtatccatgcaggggga
agagctgttcttgatgaagtcgagaagaatttgcacctaacggagtggcatatggagcca
tcacgaatgacactttacaggtttggtaatacttcaagcagctcgttgtggtacgaatta
gcctactgtgaggcaaaaggtcgcgtgaagaaaggcgaccgaatttggcagattgcattc
ggctcaggattcaaatgcaacagcgctgtgtggagagctctgcgaaccattgcgccgccg
gctctaaatccttgggatggtatcattgatcagtatcctgtgaagggggtcagtgtgcca
tgcgaattggtatttccacttcaatcagccgcttccgctggaacttccgagaggcagtca
gttgggagagacctgagtaatccgtag

DBGET integrated database retrieval system