KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_135228Help
Entry
PHYPADRAFT_135228 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K15397  
3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Fatty acid elongation
Biosynthesis of secondary metabolites
Module
Fatty acid biosynthesis, elongation, endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    PHYPADRAFT_135228
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     PHYPADRAFT_135228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 528 aa AA seqDB search
MLVLALRDVQSLKLKIELRGLAKSVTIQNLVCAPFLLVFILTAVESDQLWHTRSLQTFLW
ERLWCCSLFKVLVYFGGIVLATTLYFLYHPRRVYMLDFACHKPHEKNAISKQGLLNYAGS
SGLLSDKSLDFMRKILERSGLGDSTYVPAAITSTPADRSMVAAREEAATNMFCSLDELFA
KTGVNSKDVKILVVNSSVFCPTPSLSAMVVNRYKMRSDIKSINVSGMGCSAGLIAIDLAK
DLLHGCYRNSYAIVCSQEILCRNSYCGNDRAKLVSNCLFRMGGAAVLLSNRSRDRWRAKY
ELMHTVRTHTGPNDKCYQCVVEEEDEEGRIGVTLSKDLMSVAGEALKINISTLGPLVLPW
MEQLQFIISMVGRKVFKTNTKPYIPDFKTAFEHFCIHAGGRAVLDEVEKNLHLTEWHMEP
SRMTLYRFGNTSSSSLWYELAYCEAKGRVKKGDRIWQIAFGSGFKCNSAVWRALRTIAPP
ALNPWDGIIDQYPVKGVSVPCELVFPLQSAASAGTSERQSVGRDLSNP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctagtattagcgctgcgtgatgtccagtcattgaagttgaagattgaactgcgagga
ttggccaagtctgtcacaattcaaaatttagtttgtgcgccgttcttactggtgttcata
ctcactgcggtcgaaagcgatcaactctggcacacgaggtcgcttcaaacattcctgtgg
gagcgtctgtggtgttgtagcttgttcaaggttttagtttactttggaggtatagtcttg
gctacgaccttgtactttctctaccatcctcgtcgcgtctatatgctggactttgcatgc
cacaagccgcatgagaaaaacgccatcagcaagcaaggacttctgaattatgccggttcc
agtggtttgcttagtgacaagagtttggacttcatgagaaagatactagagcgatcgggt
ctgggagattcaacctacgtgccggcagcgatcacgagcacaccggctgaccgctcaatg
gtggcagctcgagaggaagctgcgaccaacatgttttgctctctcgacgagctatttgca
aaaactggcgtgaattccaaagacgtcaagattttggtagtcaatagcagcgtgttttgt
ccaactccatccctttctgctatggtcgtgaaccggtataagatgcgcagcgacatcaag
agcatcaacgtctcaggcatgggttgcagtgcaggtctgatagccattgacctggccaag
gatcttctccacggctgctaccgaaactcttacgctatcgtttgcagccaagagattttg
tgtagaaattcctactgtgggaacgaccgggcgaaactggtgtcgaattgcttgtttcgc
atggggggggctgccgtgttattgtcgaacaggagccgcgaccggtggcgagccaagtac
gagctcatgcacaccgtgcgaacccacactggtcctaatgacaaatgctaccaatgtgtt
gttgaggaagaagacgaagagggcagaattggagttacattgtcaaaagatcttatgagc
gttgctggagaggctctgaaaatcaatatttcaacactcggaccgttggtgcttccatgg
atggagcagctgcaattcatcatctcgatggtaggtcgcaaggtcttcaagacgaatact
aagccctacattccagatttcaagactgccttcgagcacttctgtatccatgcaggggga
agagctgttcttgatgaagtcgagaagaatttgcacctaacggagtggcatatggagcca
tcacgaatgacactttacaggtttggtaatacttcaagcagctcgttgtggtacgaatta
gcctactgtgaggcaaaaggtcgcgtgaagaaaggcgaccgaatttggcagattgcattc
ggctcaggattcaaatgcaacagcgctgtgtggagagctctgcgaaccattgcgccgccg
gctctaaatccttgggatggtatcattgatcagtatcctgtgaagggggtcagtgtgcca
tgcgaattggtatttccacttcaatcagccgcttccgctggaacttccgagaggcagtca
gttgggagagacctgagtaatccgtag

DBGET integrated database retrieval system