KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_135595Help
Entry
PHYPADRAFT_135595 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
Organism
ppp  Physcomitrella patens subsp. patens
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 334 aa AA seqDB search
MKGLMNLGNTCFFNSVMQNLVGVRMLREHFSKETIAQEGVLKLSLRKFFMEMDPNPIERS
DLDIGAERSTRARSFGNGIQQDSHELLRCLLDGLHMEEESIRKARTGADKEIESATDSKV
KENGSLDKVPKRSETLVEYMFGGQFSSTVTCCECGHSSVVYEPFLDLSLPIPSKQSLGKI
SEPMGVPILPKEEICAKKLETDAPKLVSVKRDATKRFLISKAPLVLTVHLKRFAQDSYGR
LSKLGGHITFHEQLDLGPDGVKQDGVYQLIGTVEHSGTMRGGHYVGYVKGESDESIEGTS
TWYYISDSHVRKTSLEDVLQSEAYLLFYERLSFD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggttgatgaatttgggcaacacttgcttcttcaactcagtgatgcagaatctg
gttggtgtgagaatgctccgagagcattttagtaaagaaacaattgcgcaagaaggtgtg
ttaaagttatctcttaggaagttctttatggaaatggatcccaaccctattgagagatca
gatttggacattggagccgaaagatcaaccagggctcgctcttttggaaatggtatccag
caggacagtcatgagcttttgcggtgcttactggatggattgcacatggaggaagaaagc
ataaggaaggcccgaactggtgcggataaggagattgagtcagctactgattctaaagtc
aaagagaacggaagcctcgataaagtccccaaaaggtccgagacattggtggagtatatg
tttggtgggcagttttcaagcactgtgacttgttgtgagtgtggtcactcgtcggttgtg
tatgagccctttttagacttatctttgccaattccgtctaaacaatctcttggcaagatt
tcggagcctatgggcgtgcccatattgccgaaggaggaaatttgtgcgaagaaactggaa
acggatgctcctaagttggtcagcgtgaaaagggatgcaacgaaaaggttcctcattagt
aaagcgccactcgtccttactgtgcacttaaaaaggtttgcccaagactcttatgggcga
ttgagcaagctgggcggccacatcacctttcatgagcagcttgatctgggtccggatggg
gttaagcaagatggtgtctaccaactaattggtactgtggagcactctgggacaatgcga
ggcggtcactatgttgggtatgtcaaaggagaatcagatgaatccatagaaggcacatct
acatggtattatatcagtgattcacatgttcgtaagacaagtctagaagatgtattgcag
agtgaagcctatctactcttttatgaaaggctatcttttgattag

DBGET integrated database retrieval system