KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_136474Help
Entry
PHYPADRAFT_136474 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K04688  
p70 ribosomal S6 kinase [EC:2.7.11.1]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 470 aa AA seqDB search
MATSKSKLPAAPEVSPLSLPTVQTPYYPDQLNEEYDFSDVFGHVQPHNTPPLLVVAEDVD
TIEWGPELLQDPVVVYSRSHSLVGPSPKLSLTRSHNKSACDEQGSSSAIEEAISFERECD
EHLPKELEKGNGVEKLGPQDFELLRVVGQGAFGKVFQVQKKGTSEIYAMKVMRKEKIIER
NHGDYMKAERDILTKVVHPFIVQLQYSFQTKSKLYLVLDFINGGHLFFQLFRQGTFNEDL
ARMYTAEIVLAVAHLHENGIIHRDLKPENILLDADGHVMLTDFGLAKEVKEDSHSNSLCG
TIEYMAPEIILSKGHGKAADWWSVGILLYEMLTGQPPFTQKNKQKLQQKVIKDKIKLPTY
LTADANNLLKGLLQKDPSKRLGNGPTGSRDVKQHKWFKNINWRKLEMREVTPKFVPAVNG
KQCTANFDEMWTMLPIDDSPAGTPKTTDHDFFQGYTYVSPNVWLQGDDSS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggccacctccaaaagtaaattacctgcagcgccagaagtttctccactttctctaccg
acggtgcaaaccccatattatcctgaccaattgaatgaagagtacgatttttctgacgtc
tttggccatgtacagcctcataatactcccccgctgctcgttgttgctgaggatgtagac
acaattgaatggggccctgagctactgcaagatcctgtggtcgtatactctcgatcgcac
tctctcgttggaccatctccaaagctcagcttaaccagatcacacaacaaatctgcctgt
gatgagcagggctcctcatcagctattgaggaggccatttcctttgaacgagaatgtgat
gagcatttaccgaaggagcttgagaaaggtaatggagtggagaaattaggtcctcaggat
tttgagctcctgagagtcgttggtcaaggcgcatttggtaaagtttttcaggttcaaaag
aagggcacttcggaaatctacgctatgaaggttatgagaaaggaaaagataattgagcga
aaccacggggactacatgaaggcagaaagagacattctcaccaaggtggttcatcccttc
atcgtgcagctgcaatactcttttcagacaaagtccaagctctacttggtccttgacttt
attaacggtggacatctttttttccagctttttcgtcaaggaaccttcaacgaggatttg
gcacgcatgtacactgcggagatagtgctggctgttgcacaccttcatgagaatggaatc
attcatcgggacttgaaacctgagaacatccttctagatgctgatggtcatgttatgctc
actgactttggactagctaaggaggtgaaggaagacagtcactcaaattcactctgtggg
actatagaatacatggcacctgagattattctttcaaaagggcatggtaaagcagctgat
tggtggagtgtcggcatcctactttatgagatgctcactggtcagcctccttttacgcaa
aaaaacaagcagaagctgcagcagaaggtcatcaaagacaaaatcaagttaccaacatac
ttgactgcggatgcaaacaacctcctgaaagggctgctgcagaaagatccaagtaaacga
cttggaaatggccccactgggagtagggacgtaaagcagcacaagtggttcaaaaatatc
aattggcgcaagcttgaaatgcgcgaagttacgccaaagtttgttcctgccgtgaatggc
aagcagtgcactgcgaactttgatgagatgtggacaatgttgcccatcgacgattctcca
gccgggactccgaagactactgatcatgacttttttcagggttatacgtatgtttcccca
aatgtgtggctccagggtgacgattcctcatga

DBGET integrated database retrieval system