KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_137528Help
Entry
PHYPADRAFT_137528 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHYPADRAFT_137528
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PHYPADRAFT_137528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 432 aa AA seqDB search
MMSAVKVLLDGLGEDVSRDGLLKTPLRVAQAFQGATKGYRQAAKDVVGGALFMEPGTGGT
NGSGGGCGGMVVVRNVELFALCEACLLPFRIRCHIAYVPVGERVVGLSKLPRVAEIFAKK
LQNPRRFAYEVASSLTEALQPEPLGVAVAVESWHLQWPGNGVAADLEKYVGWVPSTAYAG
TGQFEDKSGALWEELVALLQLESCSADNRNGLHKSSSTLCVEFDCDAPARPAMVAAVESL
LRSVGEDPNRKELRLTSSRFVRWLLTSTQGSRVGTPGNLDLTAGIQGLFCEADQVPNVEL
VEDVMSTEFNFPFCSQCEHHLLPFVGAVHVAYLPQRRGRGKRQQLDRNSVQRVVRGYSLR
LQVQERLTREIAEAIGGSVMVMVEASHMCMLSRGVQQVASSTSTYASLGLFSSNSRLRTA
FLQSVAKRTKSG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccgctgtgaaagtcttgctggatgggttgggcgaagatgtgagccgggatggg
cttctcaaaacgccgctgcgcgtggcacaggcattccagggcgctacgaaagggtaccgg
caggcagcgaaagacgtagtaggaggtgcgctcttcatggagcctggaacaggtggtact
aatggcagtggaggtggttgcggtggcatggtggtggtgcggaatgtggagctttttgct
ctatgtgaggcttgtcttttaccatttcgtatacgatgccatatagcttacgtccccgtt
ggagagcgcgtagtagggcttagcaagctgccgcgtgtggcagagatctttgcgaagaag
ttgcaaaaccctcgccgatttgcttacgaagttgcttcgtctttgacggaggctctgcaa
ccagagccattgggagttgcagtagctgtggagagctggcatttgcagtggccaggtaat
ggcgttgcggccgatctggaaaaatacgtgggttgggtgccttcgactgcgtatgctggg
acaggccagtttgaggacaagagtggcgcactgtgggaagagctcgtggcccttctgcag
ctggaaagttgtagtgcagacaatcgcaatggcctccacaagagtagctctacgttgtgc
gttgagtttgactgcgatgcaccagctcgaccagcaatggttgctgcagtggaatcctta
ctgaggtccgtaggagaagatcccaatcggaaagagcttcgtctaacttcttcgcggttt
gtgcgatggcttttgacatccacccaaggtagccgagtcggaacccctgggaacctagac
ttaacagcagggatacagggattgttttgtgaagctgatcaagttccgaatgtcgagctt
gtagaggatgtaatgtccacagagttcaacttcccattctgctcgcagtgcgaacaccac
ttgctgccttttgtgggagcagtgcacgtcgcctatttgccccagcggcgaggacgaggg
aagaggcagcagctggacagaaacagtgtccagagggtggtgagaggctacagtcttcgg
ttgcaagtgcaggagcgcttgacgagggagattgcggaggccatcgggggttcggtgatg
gtcatggtggaagccagccacatgtgcatgctttcacgaggtgtgcaacaagtagcatcc
tctacctctacctacgcgtctctgggtcttttctcctccaattctagactccgcaccgcg
ttcttgcagtcagttgccaaaagaactaaatctggctga

DBGET integrated database retrieval system