KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_138277Help
Entry
PHYPADRAFT_138277 CDS       T01041                                 

Gene name
HDA1501
Definition
class II RPD3 type histone deacetylase protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PHYPADRAFT_138277 (HDA1501)
Protein phosphatases and associated proteins [BR:ppp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PHYPADRAFT_138277 (HDA1501)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 534 aa AA seqDB search
MDANSPAEGKLDCSSCDDAVKNFVIQEEGEDIENDVHPFTAFLVSHDIEDEDEDEVESED
EEWQPHVRWICINCTMPNPEDEDHCWKCNEQCDSNILEQKLASVPSELTGVECKYLITCY
SKTVIGFDERMLLHEETGKSHPERPNRLRAIMEGLQASGLLSERCFTIPSREATEAELEV
VHTANHISAVQATERRGLSYFTSDTYANEHSALAARLAAGICADLASAIMTGTACNGFAV
VRPPGHHAEQDQVMGFCLHNNVCVAARAAQASGAKKVLVVDWDVHHGNGTQKIFEQDPTI
LYISLHRHEAGAFYPGTGWAHHVGSGPGEGFSVNIPWSCGGIGDEDYLSAFQHIVMPIAR
QFEPDITIVSAGFDAASGDPLGGCDVTPEGYAQMTSLLSFLAAGRILVVLEGGYNLRSIS
ASAAAVMKVLRGSNPGPLPDNLQPTPAGVGAMLDVFTIQRRYWSNLHDATFLKLETLLDT
WSKAGEGKGIKRRYIDNPVWWKWDRKRVRDQRSLILVLSMVTLSCFVSHNLSAS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaacagccctgcagagggcaagctggattgcagttcatgtgatgatgctgtc
aagaatttcgtgattcaggaagagggggaagacatagagaatgacgtacatccgtttact
gcatttcttgtatcgcatgatattgaagacgaagacgaagacgaagtcgagtcagaagat
gaagagtggcagccccatgtgcgttggatttgcataaactgcacaatgccgaatccagaa
gatgaggaccattgctggaagtgtaacgaacaatgtgattcgaacattttggagcaaaag
ttagcgtctgtgccatccgaattaacaggtgtggaatgtaaatatttaattacctgctat
tcaaaaaccgttattggtttcgacgaaagaatgttattacatgaggaaactggaaaatca
caccctgagcgcccaaatcgactacgagctatcatggaaggccttcaagcttctggattg
ctctccgaaagatgttttacaataccttccagagaagctactgaagcagaattggaagtt
gtccatactgccaatcatataagtgcagtgcaagctacagaaagacgaggcttaagttac
ttcacttctgacacatatgctaacgaacactctgcattagcggcaagactagcagctgga
atttgtgcagatctggcatcagctatcatgactggaacggcctgcaatggttttgcagtg
gttaggccacctggacatcatgctgaacaagaccaagtcatgggattttgcttgcataac
aatgtatgcgtcgctgctcgagctgcgcaggcttccggggcgaagaaggttcttgttgtt
gattgggatgttcaccatgggaatgggacccaaaagatttttgaacaagatccaacaata
ctgtatatctcccttcatcgacatgaagctggtgcgttctatcctggaactggttgggca
catcacgtggggagtggccctggtgaagggtttagtgtcaacataccatggagctgtggc
ggaattggggacgaagattacctgtcagcatttcagcacatagtcatgccaattgctcgt
caatttgagccagatataacaattgtttcagctggctttgatgccgctagcggagatcct
ctgggaggttgtgatgtaactcctgagggctatgcacaaatgacttccctcttgagcttt
cttgcagctggccggatccttgttgtcctggaaggaggttataatctgcgctctatttct
gcctcagcagctgctgttatgaaggttcttcgaggttcaaaccctggtccattgccagac
aatctccagccaactcctgcgggcgtaggagccatgctggatgtgttcacgattcagaga
cgatactggtcaaatctacatgatgcgacattcttaaaattggaaactcttctagacact
tggtccaaagctggtgaagggaaaggcattaaacggcgatacattgacaatccagtttgg
tggaaatgggatcgcaaaagggtaagggatcagagaagcctcattctcgttctaagcatg
gtcaccctctcgtgttttgtcagtcataatctctcagcaagttag

DBGET integrated database retrieval system