KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_142018Help
Entry
PHYPADRAFT_142018 CDS       T01041                                 

Gene name
HAG1502
Definition
RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHYPADRAFT_142018 (HAG1502)
Transfer RNA biogenesis [BR:ppp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PHYPADRAFT_142018 (HAG1502)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 566 aa AA seqDB search
MVLAPEQQQKKKPTPGRGGVVATLNEDEARVRCIAEIVSAMVQGCRKGENVDLNALKSEA
CRRYGLSRAPKLVELIAALPESEREMVLPRLRAKPVRTASGIAVVAVMSKPHRCPHIATT
GNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARGRIDQLKRLGHSVDKV
EFILMGGTFMSLPADYRDYFIRNLHDALSGHTSHDVDEAVRYSEHGNVKCIGLTIETRPD
YCLGPHLRQMLTYGCTRLEIGVQSTYEDVARDTNRGHTVAAVEDCFRLAKDAGFKVIVAH
MMPNLPNVDMERDMESFREFFENPAFRTDGLKLYPTLVIRGTGLYELWKTGRYRNYPPEQ
LVDLVARVLALVPPWTRVYRIQRDIPMPLVTSGVEKGNLRELALARMNDLGLKCRDVRTR
EAGIQDIHHKIKPEEVELVRRDYVANEGWETFLSYEDTHQQDILVGLLRLRKCGRNTTCP
ELMGRCSVVRELHVYGTAVPVHGRENDKLQHQGYGTLLMEEAERISLTEHRSTKLAVISG
VGTRHYYRKLGYELEGPYMVKYLKKN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttgcgccggagcagcagcagaagaagaaacctactccggggcgaggtggtgtt
gtggcgacgctcaatgaagatgaagcgcgggttcgttgtattgcggagattgtgagtgcg
atggtgcaggggtgtcggaagggggagaatgtggacctgaatgcgttgaagtcggaggcg
tgcagacgctatgggctctctcgcgctccgaagctggtcgagctgattgctgcgttacct
gagtcagagagggagatggtgttacctaggttacgagccaagccagtgagaactgcgtca
ggaattgcggtggtagctgtgatgtcgaagccgcatcgatgccctcacatcgcaacgacg
ggaaacatttgtgtttactgccctggagggccggactctgattttgaatacagtactcaa
tcatacactggttacgaacctaccagcatgcgagccatccgggcgaggtacaatccttat
gttcaagctcgaggccgaatcgaccagttgaagaggctaggtcacagtgtagataaggta
gaatttatcttgatgggaggaacgtttatgtctctgcctgctgattaccgggactatttt
attcgcaatttgcacgatgctttgtctgggcacacctctcatgacgtggacgaagctgta
cggtattcagaacatggaaatgtcaaatgcatcggcctcactattgaaacgagacctgat
tattgccttggtccccatttacgtcagatgttgacgtatggttgcacccgcctagaaatt
ggtgttcaaagcacctacgaagacgtggcacgggatactaacaggggacacacagttgct
gccgtcgaggactgtttccgacttgctaaggatgcaggttttaaggtaatagttgctcac
atgatgccaaatcttcccaatgttgatatggagagagacatggaaagcttcagagagttt
tttgaaaaccctgcatttcgcactgatggtctcaagctataccccacgctagttattcga
ggaactggcctttacgagttatggaagactggacggtaccgtaactatcccccagagcaa
ctagtagacttggtagcacgagttttggccctggtaccaccatggactcgagtgtatcga
attcaaagggacattcctatgccgcttgtcacttccggtgtggagaaaggtaatttgcgg
gagttggcattggcacgcatgaacgatctaggtttgaagtgtcgagatgtgcggactcga
gaggcaggaatccaggacatacatcataagatcaaacctgaggaagtggaacttgtccga
cgggattatgttgcgaatgagggttgggaaacattcctgtcctatgaagatactcaccag
caggatatcttggtaggactgctacgacttcgtaaatgtggacgcaataccacttgccct
gagcttatgggcagatgctctgtagtgcgagagctacatgtttatggtactgccgttcct
gtccatggccgagaaaatgataagctgcaacaccaggggtatggtacgttgctgatggaa
gaagctgagaggatctcattgacagagcatcgatctacaaagttggcagttatttctggc
gttggtactcgccactactacagaaagctagggtatgagttggagggtccatacatggtc
aagtacctaaaaaaaaactaa

DBGET integrated database retrieval system