KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_142306Help
Entry
PHYPADRAFT_142306 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ppp00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 216 aa AA seqDB search
MAASRVVIWLHGLGDSGPANQGIASFFTSPEFADFKWRFPSAPNQPVSCNGRMRMPSWFD
LPEIPIVPESPNVEEDVLKAVRSVHEMIDREVAAGISADCIFLCGFSQGGKSLRALALAS
SMLYPKTLAGAAVFSGWVALDKESFAAKITSAAKQTPVLWQHGLDDKVVEFSAGQAGPPF
LARADVKCEFQAIPDLVHSIDAEELSTLKRWMKERL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttctagggttgtcatttggttgcacggcttgggcgactccggccctgcgaat
caaggcattgcgtccttcttcacatcccctgagttcgcagattttaagtggcgatttccc
agtgctcccaaccagccagttagctgcaatggtagaatgcgaatgccgtcctggtttgat
ttgccggaaattcctatcgtcccggaatcgccaaatgtggaggaggatgtcttgaaagct
gttcgatcagtacatgagatgattgatagggaagtagctgctggaattagcgccgattgc
atatttttgtgtggcttcagccaaggaggcaagtctttgcgggccttggccttggctagt
tccatgctgtatcccaagacacttgccggagctgccgtttttagtggatgggtggcactt
gataaagaatcatttgctgcaaagattacttctgcagccaagcagacaccagttttatgg
caacacggattagacgataaagttgtggagttcagcgctgggcaggcaggccctccattt
ttggctcgtgccgacgtgaagtgtgaatttcaggccattccagatcttgtgcacagcatc
gatgctgaagaattgtccactcttaagcgctggatgaaagagagattgtaa

DBGET integrated database retrieval system