KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_142488Help
Entry
PHYPADRAFT_142488 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 467 aa AA seqDB search
MSYQRRFCCLQLPVRLTKEIVDTYHACNPSFQYTESCNPKRFLTVPSVGVSNNGSDNENH
DLILYFGRILANDDNTRRYVVKDLVGCGTFGQVAKCLILETNDLVAVKVIKNQRAYSTQA
RVEIGILHRLNNIRDRRNEHHVVRSFDHFSCEGHLCIVFELLGVNLFELLKTNNLKGISL
QLVRIFTGQLLDALSLLHDARVIHCDLKPENILLSSLRTAEIKLIDFGSACMEDHTVYSY
IQSRFYRSPEVVLGHPYSTAIDMWSLGCVAAELFLGLPLFPGQCAYDLLRFIIEKLGKQP
PDHILQKAKNTNKYFKLISAAPHPESGHTSGNASVYQFLTPEENEAREKSKPAIGKRYIS
GTLEKMIMTYPMKSAQKEEVERGTARKVFVDFLKGLIEVDPFKRWTPYEASQHPFLTDGP
FTGPFKPKKETISRVVSRTSFFVLTQLYLPPEVTILMVKKWFFLVVL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcaacggcgtttttgttgtttgcagttaccagtgaggttgaccaaggagatt
gtggacacgtaccacgcctgcaatcccagcttccagtatacagaaagttgcaaccctaaa
agatttttaactgtcccttcggttggagtttctaataatggttcagacaatgagaaccat
gatctcatcctgtactttggacgtatcctggctaatgatgataatactcgcagatatgtt
gtgaaagatcttgtcgggtgcggcacgtttggccaagtggcgaagtgcttaatcttggag
actaatgacctcgtggctgtaaaagtcattaaaaaccaacgtgcgtattctacccaggcc
agggtagaaattggcatccttcataggttgaacaacatacgcgacaggagaaacgaacat
catgttgtgagaagctttgaccacttcagctgcgaagggcatctctgcatcgtttttgag
cttcttggagttaacttgtttgaacttctgaaaaccaacaatctgaaagggatctcctta
cagctagtgcggatcttcactggtcagttgctggatgcgctaagtttgttacatgatgca
cgtgtaatacactgcgatctcaagccagagaatattttgctgtctagtttgcgtacagca
gagataaagctgattgactttgggtcagcatgcatggaagatcatacagtttactcgtat
atccagagccgattttatcgatcaccagaagttgtacttgggcatccatactcaacagcg
atcgatatgtggtctttgggttgtgttgcagctgagctgtttcttgggttgcccttattt
cctgggcagtgtgcgtatgatctcctccgttttatcattgaaaaattagggaaacaacct
cctgatcacattttacagaaggcaaagaatacaaataagtatttcaagttaataagtgcc
gctccacatccggaaagtggccacacgagcggaaatgcatcagtttatcaatttctcact
ccggaagagaatgaggctagagagaaaagtaaacctgctattggtaagcgttacatatct
ggaactctcgagaaaatgattatgacctatccgatgaagtcagctcagaaagaagaagtg
gaacgaggtaccgccaggaaagttttcgttgactttttgaaggggctaattgaagtggat
cctttcaagaggtggacaccttatgaggcttcccaacatccttttcttactgatggccct
tttactggcccctttaagccaaagaaagaaacaatatcacgtgtggtaagtcgtacctca
ttctttgtgctgactcagttgtatctgccccctgaagtaactattttgatggtaaagaaa
tggttcttccttgtagtcctttag

DBGET integrated database retrieval system