KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_143304Help
Entry
PHYPADRAFT_143304 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PHYPADRAFT_143304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1823 aa AA seqDB search
MVSYRRLLAAVEAALLTPNPAPHHRADLSHALHICVPDFQDFLKYPGPKAEDRAQVASRE
VRLPNSAPTILDNQDAQIALKLSEDYNLNEIYCVGLLVSAHQEWNSLGREPVEILRLSAG
LWFTERRALITSLQLLLRAVVLDDELDPDLVADIRSYIERLLQGGLRARLIHLIKELNRE
ESAGLGGPGVEPYVMDSRGAVVQRRNVIQKERLSLCHCLVLTCLIVRINAQEAKDLYDLL
KDSASDESISQDAVKLQITYTIMFALLDSLISDALGGSQEMGSVLALDAGFRKEFQQMLM
DAGELNVTAEGFTGVIRFVWAVYLMLTKGALDYSPTGSFSEDDTYSSLCLNRACEHDVFE
FFTTRVLQTATFQIKAMKDAAMVAVDTYVDMKDTMSDVDGKAQQQAIVLQAKPFISLLTM
IGEREPELIMDNDDLWNFVRFAGEDHNTYHTLVAFLNMLTALAASEEGAKKIYQMLQNKA
IRTLGWQTLFNSLIVYDQRFRQCLQNAGAFLPPFQEGDARALEAYLKVLRRVMEKGNEME
RSQWFMDIEPLFKLLSYENVPPYLKGALRNAIATFVPVSPVMKNKVWSFLEQYDLPVVAT
PLLSDGSAQQVYDMTFELNEVEARQEEYPSTLSYLKLLNVLIENESDGPDKGGRAYANPV
EKWELVATALRHFELMLSTYQLTEDAVRNSSDHLLPPENSLPGMAAPGLPAAITRLPVTE
LMKDLMSGKVIYRNIMSILMVGVNSVMEQRTSQLYGPALEEAISLCLQILFLALSKDTLF
SEAWRPPIDNILSHDIRQIVTVLEYVRYDMSPLIQRCSVQIMKVLSARMPQLVSIILEAG
AASSLIEDYAACLETRAEEPQAPENPDEDIGSLILRLLLANLDQPAPNVTHLLLKFDVNQ
LVERTMLQPKRHFRQVILDVLDTLARPEVNAGLHELGFQLMYELCVDPITCGPVVELLRS
EKYEFFSKHLNTFVCEPLPKRSTNQQLRVSSLQQRAWLLKLVALELHLGDMDVVVHRDSC
RRLLSRLFLREPQSWETGIPSNLMPARLTLTTTDNSIHKTKVLELLEILQFQLPESPSDF
PPELHGLKEELKVDDILGSPATVDQGGVYHISERGDRLIDLSAFRDLLWQRLEGQYNFLV
NGQKQSELREAVQQLLRWAWKRNKNLEEQAAQLHMLVGWSQLVEITISRRFHFLGSRTHV
LFEILDASISATTSQDCSLRMAFLLSQVALTTMAKLQEQSIISPGEGDSTDDVTYVDVLS
SVRLSNSACHTILSKLIASILRHESSESLRRRQYAILLSYFHYCQGMVNRDLPLSVMRTL
LVGAGDEDMEVEKLDRDQAELAQVNFSLLKRNAAPLVDVVARDATNGSETGKAMAYYVLD
ALLAVDHHQVFLSQLQSRGLLHSCLAEISSNSYQAILLPSAESLRRLYTLESELALLLRV
GFHNRKRGAQTLYAMGALRHLSSCRAIDAHLTVRRSFPSQVKVGVGMPNQHDRQHQLVSP
VLRLVLCFTSLIDSTEVVDGDRNEVALEVLDFIKSHHGLLDRILRDDNPNVHIADLDELQ
LATAILSKVWPVEESSEFGYTQAMFNLAYVYFSLDAESRNRLRKMELQVARVRCNLIAYL
YALVTKHNLRLHIYKPDVHGATMGPYNLGRQRQPTLKLVADLLQQTSLDLELALEEKALL
LARLQDVNELSRHEVDDIIKAYGRQERSDPADSIRKRWRYVAMVEMCSAAGSRECQVSSL
IFLVEHALEILYVHLEKQGRFELNLETNWGRKEDVQLLAGKLLPVFDRLECLNEDRVGRS
MKHLQRLVHSLKSRIMMLSSETY
NT seq 5472 nt NT seq  +upstreamnt  +downstreamnt
atggtctcgtaccgacgcctgctggccgcagtggaggcggcgttactgacgcccaaccct
gcgcctcaccaccgagctgatctctcacatgcattgcacatctgcgttcccgatttccag
gattttctcaagtatcctggccccaaagcagaagatcgagcacaagttgcatcgagggaa
gttaggttaccgaattctgcaccaacaatacttgataaccaggatgcacaaattgcgctc
aagctgagtgaggattacaatctaaatgaaatatactgcgtgggtttattagtgtctgca
catcaagagtggaattctttaggtcgggaacctgtggaaatacttcgattatcagctggc
ctatggtttacagagcgaagagctttaataacctccttgcaacttttacttcgagctgtg
gtcctagatgatgagttggaccctgatcttgttgcggacattcgctcgtacattgaaaga
ttgctgcaaggaggccttcgagcaagactcatccacttaatcaaggaactaaatcgagaa
gagtcagctggattaggaggtccgggagtggagccctacgtgatggattcgcgtggtgca
gtggttcagcgccgtaacgtcattcaaaaggagcggctcagcctttgtcattgtcttgta
cttacatgtctcattgttcgcataaatgcgcaagaggccaaggacctgtacgacctgctc
aaggactccgctagtgacgaaagtatatcacaggatgctgttaagcttcagatcacatat
acaatcatgtttgcgcttctcgattcattaatatcggatgcattaggagggtctcaagag
atgggctccgtacttgcacttgatgctgggtttcgcaaagagtttcaacaaatgttaatg
gatgcaggggaattaaatgtgactgccgaggggttcactggtgtgattcgttttgtgtgg
gctgtttatctgatgctcacaaagggtgccttggattatagccccactggatctttctct
gaagacgatacttactcttccttatgcttaaaccgtgcatgtgagcatgacgtttttgag
ttcttcactactcgcgttcttcaaactgctacctttcagataaaagcaatgaaggatgca
gctatggtggcagtagatacgtatgtagatatgaaagataccatgtcagatgttgatggt
aaagcccaacagcaggcaattgttcttcaagctaagcccttcatttcactgcttactatg
atcggggaaagagaaccagagctcatcatggacaacgacgatctttggaactttgttaga
tttgcaggggaggaccacaacacataccacacattagttgcctttcttaatatgctcaca
gcattggctgctagtgaagaaggagcaaaaaaaatatatcaaatgcttcagaacaaggct
attcgcacacttggatggcaaacactttttaattctttaatagtttacgatcaacgattt
aggcaatgccttcaaaatgcaggagcttttcttccaccctttcaagaaggggatgcacgt
gcattagaggcctacctcaaagtgttaagacgggttatggagaaaggcaacgaaatggaa
cgttcgcagtggttcatggatattgagccactctttaagcttctgtcatatgagaacgtt
cccccttacttgaagggggctttgcggaatgcaattgcaacttttgttcctgtatcacca
gttatgaaaaataaagtgtggagcttcctagaacaatacgatttgccagtggtggctaca
cctctgttaagtgatggctctgctcaacaagtttatgacatgacttttgagttgaatgaa
gtggaggctaggcaggaagaatatccttctacactctcttatctgaagttgcttaatgtt
ctgattgagaatgagtcagacggacctgataagggtggtagagcatatgcaaatcctgtg
gagaaatgggagcttgttgccactgcgcttcgccattttgaattgatgttgagtacttat
caacttactgaagatgctgtgaggaatagctccgatcatcttcttcctccagaaaattct
cttccagggatggccgcaccaggtcttccagctgccattactcgattgccagttacggag
ttgatgaaggatttgatgagtggcaaagtgatttatcgtaatataatgagtatattgatg
gtgggcgtcaattctgtaatggagcaacgcacaagccaactttatggcccagctttggaa
gaagcaatatccctttgccttcaaattttgtttcttgctctgtccaaagacactctattc
tcagaggcttggcgtcccccaatagataatattctatctcacgacatcagacaaattgtg
acggtattggaatatgtaagatatgatatgtcacctttgattcagcgatgctccgtccaa
attatgaaggtgctcagtgcacgaatgccgcaattggtctccattattttagaagctgga
gctgcatcaagccttattgaggactatgctgcttgcctcgagacccgtgcagaggaaccc
caagctcctgaaaatcccgatgaggatattggctcactgattttacgtcttctcctggct
aatttggatcagcctgctccaaatgtaacgcatcttcttctaaaatttgacgtcaatcaa
cttgtagagaggacaatgcttcagccgaaacgtcacttcaggcaggtgatactggacgtc
ttggacacgcttgcaaggccagaagtgaatgctggactgcatgaacttggtttccagttg
atgtatgaactttgtgtggatccaatcacttgtggtcctgtggtggaacttctcagaagt
gaaaaatatgagtttttctccaagcatttgaatactttcgtgtgtgaacctcttcccaag
cgcagcacaaatcaacagctgcgtgtgagcagcctacaacagagagcctggctgctgaag
ttggtcgctttggaacttcacttgggcgatatggatgtcgttgtccatcgagacagctgt
cgtcggctcctttctcgcttatttttgagagaacctcaatcttgggagacggggattcca
tctaaccttatgccagctagattgaccttgactaccactgacaacagcatccacaaaacc
aaagtgttagagcttctcgaaatcctccaatttcaactccccgaatctcccagcgacttt
ccgccagaattgcatggtctgaaagaggagcttaaggttgatgatatccttggcagtcct
gctacagttgaccaagggggtgtataccacatctcagaacgtggggatcgtcttattgac
ctctcagcatttagagatctactttggcagaggttggagggtcagtacaactttctggtg
aatggtcagaagcagtctgaacttcgggaggcagtgcaacaactattgcgttgggcttgg
aagcggaacaaaaatttagaggagcaagctgctcaactacatatgctcgtaggatggtcg
cagcttgtagagataacaatatcgagaaggtttcactttttgggcagtcggacgcatgta
ctttttgagattttggatgcctcaataagtgcaactacatcacaagattgctctttacgc
atggccttcttgctaagtcaagtggctctgacaactatggcaaagcttcaagaacaaagc
attatatcacctggtgaaggcgatagtacagatgatgtcacatatgtggatgtgttgtct
agtgtgcggttatcgaacagcgcatgccacaccatcctgtctaagcttattgcctctatt
ctgagacacgaatcctcagagagcttgcggcgcagacaatatgcgatacttttgagctat
tttcattactgccaaggaatggtgaaccgagatttgcccctttctgttatgcgaactttg
cttgttggcgccggtgacgaggatatggaagttgaaaagctggaccgagaccaagccgaa
cttgcgcaagtgaacttctctctcctaaagcgaaatgcagcccctcttgtggatgtggtg
gctagggatgctacaaatggtagtgagacaggtaaggctatggcctactatgtgctggac
gcattacttgcagttgaccatcaccaggtgtttctcagccagttacaaagtcgcggactc
cttcattcatgcttagctgagatcagcagcaactcttatcaagccatattacttccctca
gccgaatccttgcgtcgattatatacgttggaatcagagctggctctactccttcgagtg
ggattccacaatagaaaacgtggggcacagacattgtatgcaatgggagcccttcgtcat
ttgtcctcttgccgagctattgatgctcatttgactgtaagacgatcttttccttcacaa
gtaaaggttggtgtaggaatgcccaatcagcatgatcgtcagcatcaactcgtatcgcct
gttctacgcctggtcctttgctttacttctttaattgactctacagaagtggttgatggg
gatcgaaatgaagttgctcttgaagttttggattttatcaagtcccatcatggcttactt
gatagaatcctaagagatgacaacccaaacgtgcacatcgcagatctggatgaactccag
ttggctactgcaatccttagtaaggtatggccggttgaggagtcttctgaatttgggtac
acgcaagcaatgttcaaccttgcgtacgtctacttcagcctagatgcagagtctcgaaat
cgtttaaggaaaatggagctccaagtggctcgtgtacgatgcaatttgattgcttactta
tatgccttggtcacaaagcacaacctgcgtctgcatatttacaagcctgatgtgcacggt
gcgacaatggggccgtacaatttgggacgccagagacaaccgacgctgaagcttgtcgct
gaccttttgcaacaaacatctctggacttagagctagccttagaagagaaagctcttctt
cttgctaggcttcaagacgtaaatgaactttcgcgccacgaggtggatgatataatcaag
gcttatgggcgacaagagcgttcagatcctgctgatagcatccgcaagaggtggagatat
gtggcgatggtggagatgtgcagtgcagctggtagccgtgaatgtcaagtttcttctctt
atttttctagtggagcatgccctggagattctatatgtccatttggagaagcagggtaga
tttgagctaaatcttgagacgaattggggccgaaaagaagatgtacagttactggctgga
aagctgcttccagtgtttgatagacttgaatgtttgaatgaggatagagtgggtcggagc
atgaagcatttgcagcgccttgtgcactcgctgaagtcgagaattatgatgttatcatca
gaaacctactga

DBGET integrated database retrieval system