KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_143855Help
Entry
PHYPADRAFT_143855 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PHYPADRAFT_143855
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    PHYPADRAFT_143855
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     PHYPADRAFT_143855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 303 aa AA seqDB search
MEGFALQHQHGKAKVRVGRLWRGATSQEHRFVEWNVSVSITSFVLPAFTDGDNSKIVATD
SIKNTIYYLAKQCTEELSLEDFGVVVGQHFLRTYPKIVTGAKVILSQKPWERVVVDGVEH
NHGFKLGSGKHTAEVIIGSNGCVKVTSGITDLSLLKTTQSGFEKFVRDQFTILPDTDERM
LASTITGVWRYACISSYSGKPANYQRSWEAVKKVLMDTFFGSPPTGVYSPSVQHTLYQMA
KAVLVRFPEIENIHLNMPNIHFLPVNLPTVGVKFENDVFLPTDEPHGSIEAKLSRMEIFQ
CKL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggagggcttcgcgcttcagcaccagcatggaaaggccaaggtgagagtcgggcggttg
tggcggggcgcgacatcccaggagcaccgcttcgtggagtggaatgtctccgtatcgatt
acctccttcgtccttcctgctttcacggatggtgataactccaaaattgtcgccacggac
tccatcaagaatacgatttattatttggccaagcagtgcacagaggagctttcattggaa
gattttggggtcgttgtgggacagcatttcctgcgcacctatcccaagattgttactgga
gccaaagtcatactatctcagaagccgtgggagagagtagtcgtggatggagttgagcac
aatcatggttttaagttgggctctggtaaacacaccgcggaagtcatcatcggcagtaac
ggatgtgtcaaagtgacatctggaatcaccgatttgtcgttattgaaaacaactcagtct
ggatttgaaaagtttgtccgcgaccagttcaccatattgccagacacagatgagcgcatg
ctagcctcaaccatcactggcgtgtggaggtatgcatgcatttcttcttactccggcaag
cccgcgaattaccagaggagttgggaagcggtgaaaaaagtacttatggacacatttttc
ggttcgccccccactggtgtgtatagtccctccgtccagcatactctgtatcaaatggct
aaggccgtactagtcaggtttccagagatcgagaacatacacttgaacatgccaaacatc
catttcctacctgttaacttacctacggtgggcgtcaagttcgagaacgatgtctttctt
ccaaccgatgaaccccatggttcgatagaagccaagctctcccggatggaaattttccag
tgcaagttatga

DBGET integrated database retrieval system