KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_145772Help
Entry
PHYPADRAFT_145772 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_145772
  Amino acid metabolism
   00340 Histidine metabolism
    PHYPADRAFT_145772
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PHYPADRAFT_145772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 460 aa AA seqDB search
MAQVAATEEATKASGIKVHKLSELSADEVRGLRARPRIDFTSIFETVGPIVENIRSRGDA
AVKEYTSKFDRVDLKSVIDKIEDLPDPVLDPEVKAAFDVAYENIKCFHAAQQKNQQLQVE
TMPGVSCKRVPRAINNVGLYVPGGTAVLPSTTLMLAVPAQIAGCKTVVVATPPRKDGSIC
PEVLYCAKKSGVTHILKAGGAQAVSAMAWGTETCPKVDKVFGPGNQYVTAAKMVSTYTCQ
CFYISQNSEAMVSIDMPAGPSEVLVIADKLASPVHVAADLLSQAEHGPDSQVVLVAVGDE
VDIAAIQQEVERQCRELPRDTIATSALSHSYIVVAKDMPEACDFSNMYAPEHLIVNVEDA
EQWLDSLDNAGSIFMGRWTPESVGDYASGTNHVLPTYGYSRMYGGVSLDSFVKYMTVQSL
TADGLQKLGPYVAKMAEVEGLDAHKRAVTLRLRDISASGQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggttgcagctacagaagaggcgactaaggcctcaggaatcaaagtgcataaa
ctctctgaacttagtgccgacgaagttcgaggtcttcgagcccgtcctcgcattgacttc
acttcaatctttgaaacagttggccctattgtagagaatatccggagtcgtggagacgcg
gctgttaaggagtatacaagcaagtttgaccgagtagatcttaaaagtgtaatcgataaa
attgaggacttgcctgacccggtgcttgatcctgaagtaaaagcagctttcgacgtagct
tatgagaacatcaagtgtttccatgctgcgcagcagaagaaccaacaacttcaagtggaa
actatgccgggcgtgagctgcaaaagagtgcctagagccatcaacaatgtcggtctttat
gttccaggaggcactgcagtccttccatcgactactcttatgctggctgttcctgcacag
attgccgggtgcaagacagtggttgttgcaacaccaccaaggaaagatggctctatctgc
cctgaagtattgtactgtgcaaagaagtcgggtgtgacccacattttgaaagctggtgga
gctcaggctgtttcagcaatggcttggggtactgaaacatgtccaaaggtggataaagtt
tttggacctggaaatcagtatgttacggctgcaaaaatggtatcgacttatacttgccaa
tgcttctatatttcacagaatagtgaagcaatggtgtccatcgatatgcctgccggtcca
tcagaggttctagtaattgccgacaagcttgcttcccccgttcacgtggctgcagatctg
ctttctcaggcagaacacgggccagatagtcaggtggtccttgtagcagtaggtgatgaa
gtagacattgctgctatacagcaggaggtggagagacaatgcagagagctacctagggac
acaatcgctacatcagctctttctcacagctacattgttgttgcgaaggacatgccagag
gcatgtgatttttcaaacatgtatgctcctgagcacctgatcgtcaacgtggaggatgcg
gagcagtggttagactctctcgataatgcaggttctatatttatgggaaggtggacacca
gagagcgtgggtgactacgccagtggaaccaaccatgtgctgccaacatatggttactct
cggatgtacgggggcgtgtccctcgattccttcgtcaagtacatgaccgtgcagtccttg
accgcagacggcttgcaaaagctggggccttacgtcgccaaaatggctgaagtagagggt
cttgacgcgcataagagagcagtgacattgcgactgcgtgatattagtgcttcaggtcaa
taa

DBGET integrated database retrieval system