KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_146128Help
Entry
PHYPADRAFT_146128 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppp00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppp00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 333 aa AA seqDB search
MLIAGCAASPNDTINAQQSTLNNRFPLQDVLEAQQFDRKLLNSIFEVAREMEDIERDAAG
SELLKGFLMATLFYEPSTRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDTIRTV
EGYSDIIVLRHFESGAAKKAANTANIPIINAGDGPGQHPTQALLDMYTIKREIGHLDNIR
VGLVGDLANGRTVRSLAYLLAKYDGVKIYFVAPDVVKMKDDIKDHLTDSGVDWEESTDLM
EVASKCDVIYQTRIQRERFGDRIDLYNAARGKYIVDTKVMNVLPKHAVVLHPLPRLDEIT
VEVDSDPRAAYFRQAKNGLHIRMALLKLLLLGY
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctgatagctggctgcgctgcttcacctaatgacacgatcaatgctcagcaaagcact
ttgaacaacaggtttccattacaggatgtactggaagcgcagcagttcgacaggaaactt
ctgaactctatctttgaggtggcaagggaaatggaagacatagagagggatgctgctgga
tcggagctgctgaagggattcttaatggctaccctgttttacgaaccttccactcgtact
aggctttcgttcgaatccgctatgaagaggctgggtggagaagttttgacgactgaaaat
gctcgtgaattttcttcagctgccaagggcgagaccctggaagataccattagaacagtc
gagggctattcggatattattgtgctcaggcacttcgagagtggggcagccaagaaggct
gccaatacagcgaacattcctatcataaatgcaggagatggtcctggtcagcatcctaca
caggcgctgctcgacatgtatacaataaaacgagagattggccatctggataacataaga
gtggggttggtgggtgatttagctaatgggcgaactgtacgatcattggcttatctgctt
gcgaagtacgatggagtcaaaatttactttgttgctcctgatgtggtcaagatgaaggat
gatatcaaggaccacctgactgattcaggagtcgattgggaagaatccactgacctgatg
gaagtggcatcaaagtgtgatgtgatataccaaactcgtatccaacgtgagaggtttggt
gaccgcattgacttgtacaatgcggctcgtggaaagtatattgtggataccaaggttatg
aatgtgttacccaagcatgcggtggttctccatcctctaccacgtctcgatgagataact
gtggaagtggacagtgatccccgagctgcttacttccgtcaagctaagaatggtctgcac
attcggatggccttactcaagctgcttcttcttggctactaa

DBGET integrated database retrieval system