KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_146208Help
Entry
PHYPADRAFT_146208 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ppp04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 480 aa AA seqDB search
MEGTLNIAQRTKKVDVDNRLPLKYYYRTADNLLKQARIFRDEGNTIDYYILLLRFSSLVS
ETIPEHRECRLYSREFVDYRKRLIDVVTELERLKPGVQKQVEQYNNSLLKPRGSSYSLPS
SYSTPSHYDTPSHNTAFSYDIPSHNLVAMELEPKFRSLNIPRPTEETLSRHSILGPSTQR
PRREPAPLRVQYPSYVDATPIELPSFIQDWNVPAQFPAASTSVPTTNVSSTVAALESLSD
PALWSGSQSSVTVDVAPTMTLLRQPSPPPIAASVQTVHAVHDVHDHSQTQLSSDLAHHDL
SLSLPQSTKMMDEFMRLAKANTTRNLETCGVLAGSLKKGIFYVCTLIVPKQEATSDSCQT
INEEEIFDSQDKRGLFQLGWIHTHPTQTCFMSSIDLHTHYSYQIMLPEAIAIVMAPTDNS
RPYGIFRLSDPGGVKTIQQCQQRGFHPHEDPPDGSPIYECCSHVYMNPKLQFDVIDLRAQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggagggcactctgaatattgcgcagaggacgaagaaggtggatgtggacaatcgactg
ccattaaagtattattaccggacggcagataatcttctgaagcaggctcgaatttttcgc
gatgaggggaatactatcgattactacattcttctgcttcgattttccagcttggtttct
gagaccatacccgaacatcgcgagtgtcggttgtattcaagggaatttgttgattacagg
aaaagattgatagatgttgtgacggagcttgaaaggctgaagcctggagttcagaagcaa
gtcgagcagtacaacaattctcttcttaagcccaggggatcttcatatagcctaccttct
tcatacagtactccttctcattatgatactccttcccacaacaccgctttttcatatgac
attccctcacataatttggtggcaatggaactcgagcccaagttccgatccctgaacatt
ccaagacctacggaagaaactctttccaggcattctatccttggaccaagtacgcagcga
ccacgaagggagccggcacctctaagggtgcaatacccaagctatgttgatgctacaccg
attgaactaccaagcttcatccaggattggaatgttcctgctcaattcccagctgcgtct
acaagtgtgcctactacaaatgtgtcttcaactgttgccgctttggagtctttatcagat
ccggcactttggtctggctctcaatcatccgtcacagtcgatgtagcccctacaatgaca
ttgctcaggcagccctcgccacctcctatcgccgcttctgtacagacggtgcatgctgtc
catgatgtacatgaccactctcaaactcagttgtcatctgacctggctcatcatgatttg
tcgttgtctttgccccagtccacaaaaatgatggacgaatttatgcggctggcgaaagct
aatactactcgcaatcttgagacatgtggggttcttgctgggtctttgaagaaaggcatc
ttttatgtttgcaccttgattgttccaaagcaggaagctacatccgactcatgtcaaaca
attaatgaggaggagatatttgattcacaagacaagcgaggacttttccagcttggttgg
atacatacacatccaacacaaacttgtttcatgtcctccattgatctccacacccattac
tcttatcagatcatgttgccagaggctattgctatagtgatggcgccaactgacaattct
cggccttatggtattttccgcttgtctgatcctggaggtgtaaaaactattcaacaatgt
caacagcgtggttttcatccccatgaagatcctccagatggaagccctatatatgagtgc
tgcagccatgtttatatgaacccaaaattgcagtttgatgttatagatctacgagcacag
tga

DBGET integrated database retrieval system