KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_147034Help
Entry
PHYPADRAFT_147034 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1006 aa AA seqDB search
MGSGGDLGGRTNSLRRLKRLNILFKLPYNTQWGQNLMIIGSDALLGAWVVEKGQRLMPRQ
EGDVLVWEVSISVSERFETEYNYVVVDDRFRGLRRESGARRVLSLPEGLSNGATVEVHDL
WQDSPETLFTKEAYRKVLFGDEACKSTHIEGELSKDPTQCFTNVPLNPSAVVVQFKIANS
VLHPDQAVFVIGSSSELGQWNNEAAIALSNTVGYSWECLVSISRTEFPVSYKYILKNSSG
VVTYENDENRVLSLSLSAKKSSSVLIAADGSFRSKPWRGAGVAIPVFAIRSTESVGAGEF
LDLKLMVDMAVKTGMRLVQLLPVNDTSVNMMWWDSYPYSSLSVFALHPLYLRLQALSNKL
PNDIKEDIENYRKQLDMKEVDYEATLAAKLSIAKRVYNLEKDLVFNSALFKKYFDENKGW
LQPYAAFCFLRNLFGTSDHSQWGLYGDFTQEKLDKLVSPMGDYYDAVAFSYYLQFHLHSQ
LAEVRDYAMKKHVVLKGDLPIGVDRNSVDTWQFPSLFRMTASTGAPPDYFDMNGQNWGFP
TYVWEEMAKDNYGWWRARLSQQMAKYFSAYRIDHVLGFFRIWEMPDHAVTGLMGRFRPSI
PLSTEELEREGIWDFQRLSTPYVRCHILQGKFGDRWTEVAENYFDEFEHLCYQFKEEYNT
EKKIISATTLKDNASSFAIQEAEADRTRLFDLLHEVILMRDRDDPSKFYPRFGMDKTVSF
DELDDHSKNVLKSKYNDYFFHRQEQLWRDNALMTLPALLNSSDMLCCGEDLGMVPACVQP
VLSELGLLGLRIQRMPSAPGQEFGNPADYEYMTVCAPSCHDSSTMRAWWEEDEGRRERFF
RNMLGLTDPPPETCDPHVSHLILQQHLESPSMWAIFPLQDLMALKDEYAKRPANEETIND
PTNPRHYWRFRVHIPMETLLCDDDFVGIIRDLVVSSGRATSKDFDLSSSSIVPAVRDHEL
KHVNKTVSGKRLDDNKIIIDRTYSGEGLDVAKPVVATSYFNTIVTA
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcggcggggatctaggtggacgaacaaacagtttgcgtagacttaagagattg
aatatcctattcaaacttccatacaatactcaatggggccaaaatcttatgattattgga
tcggatgcattactaggagcctgggttgtggagaaggggcaaagattgatgcctcgtcag
gaaggagacgttctcgtatgggaggtttcgatctcagtatcagagcgttttgagacagaa
tataactacgtcgtcgtggatgatagattccgtgggttgaggcgagagtctggagcacgg
agagtgctcagtttgccggagggattgtctaatggagcaacagtagaagtccacgatctg
tggcaggattctcccgagacgctcttcacaaaggaagcatataggaaagttctgttcgga
gatgaggcttgcaaatccacacatattgagggggaactcagcaaggatcccacgcaatgc
tttactaatgttccgctcaatccgtcagctgtagtcgtccaattcaagatagcgaactca
gttctgcatcctgaccaagcggttttcgtcataggcagttcttcggaattgggtcaatgg
aacaatgaggctgcgattgctttatcaaacactgttggctacagttgggaatgtttggtg
tcgatttcgagaacggagttccctgtgtcgtacaagtacatactgaagaacagtagcgga
gtagttacgtatgaaaatgatgaaaatcgagtgctatcattaagtttatccgcaaagaag
tctagctctgtgcttattgcagctgatggaagcttcagatccaagccatggagaggggca
ggtgttgcaataccggtgtttgctattcgatcgacggaaagtgtgggtgccggagagttt
ttggatcttaaattgatggttgatatggcagttaagacaggaatgcgtctagtccaatta
ttgcccgttaatgacacttcagtcaacatgatgtggtgggactcatatccgtacagctca
ttgtctgtatttgcattgcatccactgtaccttcggcttcaagcgctctcaaacaagctc
ccaaatgatatcaaggaggacattgagaattacaggaaacagttggatatgaaggaggtt
gattatgaggcaactttggctgcaaagttatccatagccaaaagagtttataatctggag
aaggatctagtttttaattcagcattgttcaagaagtactttgatgaaaataagggttgg
ctgcaaccttatgctgcattttgctttttgcgtaacctttttggcacttcagatcactct
caatggggtttgtatggtgattttacacaggagaagttagataaactcgtctcaccaatg
ggggactattacgatgctgttgccttcagttattacctccaatttcatctgcattcgcaa
ctcgcagaagtaagagattatgctatgaagaagcatgtagtgctcaaaggagatttacct
attggcgtagatcgtaacagtgtagatacctggcaatttcccagcctcttccggatgact
gcatctactggtgctccaccagattattttgacatgaacgggcagaattggggatttccg
acctacgtctgggaggaaatggccaaggacaactacggctggtggagagctcgactttct
cagcagatggcgaaatacttcagtgcctacaggatagatcatgttttggggttcttccgt
atttgggagatgcctgatcatgccgtaactggacttatgggaagatttaggccatccatt
cctctcagcacagaggaattggagagagaaggtatatgggatttccagcgattgagtaca
ccgtacgtgcgttgtcatattcttcaagggaaattcggggatagatggacagaagtagca
gaaaattacttcgatgagttcgaacacttgtgctatcaattcaaagaggaatataatacc
gagaagaagatcatttcagcaacgacgttgaaagataatgcgtcgtcatttgcaattcaa
gaggccgaggccgatcgaacccgactctttgatctcctacatgaagttatccttatgcga
gatagagatgatccgtcaaaattctacccacgttttggcatggataaaacagtcagcttc
gacgagctggatgaccacagtaagaatgttctgaagagcaaatacaacgattactttttt
catcgtcaggagcaactatggcgtgataatgctctgatgactttgcctgctttgctgaat
tcgtctgatatgctatgctgtggagaagatcttgggatggttccagcttgtgttcaacca
gtcttaagcgaactcgggcttctgggtcttagaattcagcgaatgcccagtgctcctgga
caagagttcggcaatccagctgattatgaatacatgacagtttgtgctccatcatgccat
gattcatcgactatgcgggcatggtgggaagaagatgaaggtagaagggagcggttcttt
aggaatatgttggggctcacagatcccccacccgaaacttgtgatcctcatgtttcccat
cttattctccagcagcacctggaatctccatcaatgtgggcaatatttcccctacaggat
cttatggcactgaaagatgagtatgccaagcgaccagccaacgaagagactatcaatgac
cccaccaacccaagacactattggcgattcagagtacatattcctatggagacacttttg
tgtgatgacgattttgttggaatcatacgtgaccttgtagttagcagtggacgtgccact
tccaaggacttcgatctcagcagttcctcaattgtgcctgctgtgagagaccatgagtta
aagcatgtgaacaagacggtatcaggaaagagactggatgataacaaaattattattgac
agaacttactcaggtgaaggtttggatgtcgcaaagcctgtagtcgcaactagttatttt
aatactattgtcacagcataa

DBGET integrated database retrieval system