KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_147634Help
Entry
PHYPADRAFT_147634 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PHYPADRAFT_147634
  Replication and repair
   03420 Nucleotide excision repair
    PHYPADRAFT_147634
Transcription machinery [BR:ppp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PHYPADRAFT_147634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 308 aa AA seqDB search
MADFTTSTHRKRWILNPHDLTRKYQAANQRAVDALHKYGATRVEVQPDGSLTYPGPLPEH
LSVEEELLVRRFYENKIQQVCAAFRLPYKIQATAIMYFKRFYQQWSVMEHDPKNIMLTCI
YLACKVEESHVSAEELGKGIQQDPQVVLKNEMIVLQGLEFELIVYTPYRSMEGFIYDMEV
RCFVWKTYRLHSEQELRAVAGRVVDNMMLTDAPLLYPPGQLALAALRIANQEPKVDLDGY
LQALPEHKSLQQSYAELIAKLDAIQFLVKGTKQPVEAEVRHIDRKLKYCRNPSLQDEYVT
SLRAYLLT
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggctgacttcacgacgtccacgcatcggaagcggtggatccttaatccccatgatctg
accagaaagtatcaagccgcgaatcaaagggcggtggacgctctgcacaagtatggcgca
actagagtggaagtacaaccggatgggagcctgacctaccctgggcccttaccagagcat
ttatcagttgaagaggagctccttgttcgaagattctacgagaataaaattcagcaagtt
tgtgcagcttttagacttccttacaaaattcaggcaacagctataatgtattttaagaga
ttttaccaacaatggtctgtcatggagcacgaccccaaaaatattatgctcacatgtata
tatctggcatgtaaagtagaggagtcccatgtttctgccgaagaattgggaaagggtatc
cagcaagatcctcaagtggttctcaagaatgagatgattgtattacaaggtctagagttt
gagctcattgtttatactccttatcgttctatggagggcttcatctatgatatggaggta
agatgttttgtttggaaaacttaccgattgcactctgaacaggagttacgagcagtagct
ggacgtgttgtggacaatatgatgcttacagatgcacctctactgtatcctcctggccag
ttagcgttggctgcgcttcggattgccaatcaagagcctaaggtggatttagacggatat
cttcaagctctcccagaacataaaagtctgcagcaatcatacgctgaattgattgctaag
cttgatgctattcagtttctggtcaaggggactaaacagcccgtagaagcagaagtgagg
cacatcgaccgcaagcttaaatattgtagaaatccaagcttacaagatgagtatgtgact
tcacttcgtgcatatttgctaacttag

DBGET integrated database retrieval system