KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_147990Help
Entry
PHYPADRAFT_147990 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PHYPADRAFT_147990
Exosome [BR:ppp04147]
 Exosomal proteins
  Proteins found in most exosomes
   PHYPADRAFT_147990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1697 aa AA seqDB search
MAANGPITVKEALALTSIGILPQFVTFTHVTMDSDKYICVRETSPQNNVVIIDMASPMQP
LRRPITADSALMNPSSKVLALKGKLAQIPGTTQDHLQIFNIELKSKVKAHMMLEQVVFWK
WVTSSLLGLVTQTAVYHWSIEGESEPQKMFERTASLMSNQIINYRCDASEKWLVLIGIAP
GSQERPALVKGNMQLFSVDQQRSQALEAHAAVFASIELPGGDHSSTLISFATKTVVAGQI
ISKLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQITSKYNLIFVITKLGLLFVY
DLETATAVYRNRISPDPIFLTAEATEAGGFYAINRRGQVLLATVNEATIVPFVSIQLNNL
ELAVSLAKRGNLPGADNLIVQRFQELFLEHKHTEAAELAAESPQGILRTPETIARFRTVP
IQAGQTSPLLRYFGTLLNKGKLNAFESLELTRLVVSQKKNHLLETWLTEDKLDCSEELGD
LVKSVDKDLALKIYIKARASPKVVVLFAQRQEFEKILIYSNQVGYTPDYLSLLQTITQTD
PQGAVNFAVKMSEMKGGSPVDYNTITDFFLQRNMIREATAFLLDVLKPNLPEHGALQTKA
LEINLVTFPNVADAILTNGIFKHYDRPRIAQLCEKAGVYMRAMQLYTELSDIKRVIINTH
AIESQALMDFFGTLSKDWALECMKELLSANLRANLQIVVQVAKEYAEQLGINACINMFDE
FKSYEGLFLFLNFYVNSSEDPEVHFKYIESAAKTAQFKEVERITRESNFYPAERTKSFLM
EAKLQDARPLINVCDRHDFVPDLIHYLYVNNMLRFIEGYVQKVNPSKAPQVLSQLLDDDC
PEEFIKGLLLSVRSLLSVEALVDECEKRNRLKLLTPLLEHLVSEGSKDVQVHNALGKVTI
DTNNNPEQFLYTNSYYDSRVVGKYCEKRDSSLAVVAYRRGQCDDELVNVTTRNSLFKLQA
RYVVERMDATLWAKILDPENPFRRQLIDQVVSTALPESKSPEQVSVTVKAFMSANLPNEL
IELLEKIVLQNTAFSSNPNLQNLLILTAVKTEKSRVMDYIHRLENFDGPAVGEIAVGAQL
YEEAFMIFKKFNLNVQAVNVLLDNLHSIGRAAEFAERVEVDEVWSQVGKAQLRDGPISDA
IDSFVRAKDASQFTNVIREAGKLKAYDNLVRYLIMVRQKVKEPQVDSALIFAYAKMSRLD
DLTEIVAQPNGCVANLLVVGDRLFNEELYQAAKVVFSHIGNWPRLTSTLVKLYQFQAAIE
VAHKANSSKTWREVCFACVDTEEFRLAQICGLKIIIQVDLLEEVSEYYQNKGNFDELIML
MESGIGLERAHMGIFTELGILYAKYRPEKLMEHLNLFSTRINIPKLLRICDEHHHWKELS
YLYIQYEEYDNAAATIMGHSPDAWDHIQFKDVVSKVANVELYYKAIQFYLQEHPEILNDL
LAVLVTRVDHSRAVDIMRKAGHLPLVKPYMQAVQNCNLSAVNEALNELYIEEEDYEMIRE
SIDTYDNFDPIAMAQRIENHELLEMRRIAAYIYKKAGRWQQSVALSKKDNLFSDAMETTS
QSGDSVFVEELLTFFVKEGKKECFAACLYTCYDLIQADVVIELAWMNNMMDFAYPFLLQY
LREYSLKVAHLMSYKNQDDVHGKLDHNLVADSNMYAQLLPLALPAPPIVAASGTFDAYAG
LPAYGLLQSRGSTSPTY
NT seq 5094 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaacggtccgattactgtgaaagaggctctggcgcttacaagcatcggaatc
ctcccacagtttgtcacattcacacatgtgactatggattctgacaagtacatctgcgtg
cgcgagacatcgccacaaaacaatgtagtgattatcgacatggcttcgcccatgcagccg
ttacgaagacccataacagcagactcggctcttatgaatccatccagcaaagttctcgcc
ctcaaaggcaagttagctcaaattcctggaacaacacaagaccatttgcagatcttcaat
atcgagttgaagtcgaaagttaaggctcacatgatgctggagcaggttgttttctggaaa
tgggttacatcaagtttgctagggcttgtcacacagacagcggtgtatcactggtcaata
gaaggtgagtctgagcctcagaaaatgttcgagaggacggcgagtctcatgtccaaccag
ataattaactaccgatgcgacgcatctgagaagtggctcgtgctcattggcattgcacct
ggatcacaggagcgtccggcactggttaagggcaacatgcagctgttctccgtggaccag
cagcggagtcaggccctggaagctcatgcagcagtcttcgcgtcgattgagcttccaggt
ggtgatcattcctccactctcatctcattcgcgactaaaacggttgtggcggggcaaatc
atctccaagctgcatgttattgaactaggagcccaaccaggcaaacctagttttaccaaa
aagcaagcagatcttttcttcccgccggacttcgcagatgatttcccagtggctatgcaa
ataacctccaaatacaacctgatttttgttattaccaagctcgggttactttttgtttac
gacctagagactgcaacagccgtttacagaaaccgaattagccccgatccaatctttttg
acggcagaagctactgaagcaggtgggttttatgcaattaatcgccgtggacaagttttg
cttgccactgtgaatgaagcaacgattgttccgttcgttagcatacagttgaataatctg
gagcttgccgtcagtcttgcgaagcgaggaaatctaccaggggcagataatttgattgta
cagcgatttcaggagttgttcctcgagcataaacacacagaagcagcagagctcgcagca
gagtcgccccaaggcattctccgcactccagaaaccatagccaggtttcggactgtaccc
atacaagcagggcagacctctccattgttgcgatactttggaaccttgttgaacaaagga
aaattaaatgctttcgaatccttggagcttacccgtttggttgtaagccaaaagaagaac
catttgttggaaacatggttaacagaggataaactagattgcagtgaggagctgggagat
cttgtaaagagcgtagataaggatttggcactaaagatctacattaaagctagggcttct
ccaaaagtagtggtactgtttgcccaacgtcaagaatttgaaaagatccttatttattcc
aatcaggttggctacactccagactacttatctttgctgcaaactatcacacaaacagat
cctcagggggcggtgaattttgcagtaaagatgtcagaaatgaaaggtggcagtccagtg
gactataataccattacagattttttcctccagcgtaacatgattagggaggccactgca
ttcctacttgatgttctcaagcccaacttgccggaacatggtgctcttcaaacaaaggct
ctcgaaatcaatcttgtcacttttccaaacgtcgcagatgcgattttgactaatggcatc
ttcaaacattatgaccgtcctcgaattgctcagctttgtgagaaggctggcgtgtatatg
cgtgctatgcagctctatacggagctgagcgacatcaagcgtgtgatcatcaacacccat
gccatcgaatctcaggcattgatggatttctttgggacgctctccaaagattgggcatta
gaatgtatgaaggaacttctttcggctaacttgcgagccaacttgcaaattgtggtccag
gtggccaaggagtatgctgagcaactaggcattaatgcttgtattaacatgtttgatgaa
ttcaagtcctatgagggtttatttctcttcctcaatttctatgtgaactccagtgaggat
ccagaggttcatttcaaatacattgaatctgcagcaaagactgctcagtttaaggaagtt
gaacgcatcacaagggagtccaatttctatccagctgagcgaacaaaatcttttctaatg
gaagctaaactacaggatgctcgccctcttataaatgtctgtgatcgccatgattttgtg
cccgatttaatacattatctgtatgtgaacaatatgctgcggtttatagaaggatatgtt
caaaaggttaatccaagcaaagcaccacaagtcttaagtcaattattggatgatgactgc
ccggaagaatttatcaaaggattgctgctctccgttcggtcactattgtcggtggaggca
cttgtggacgaatgtgagaaaaggaatcgactcaaactgctgacgccgttactggagcac
cttgtaagcgagggaagcaaagacgttcaagttcacaatgccttggggaaggttactatc
gacacaaataacaacccagagcagttcctatatacaaattcatactatgattctcgagtt
gttggcaagtattgtgagaaacgggattcgtcactagcggtagtggcatatcggcggggt
caatgtgatgatgaactagttaacgtgacaacaagaaactcccttttcaagcttcaggct
agatatgtggtggagcgtatggatgcgactttgtgggctaagatattagaccctgagaac
ccattcaggcgtcagttgattgaccaggtggtatctacagcactaccagagagcaagagc
cctgagcaggtctcagttactgtgaaagccttcatgtctgccaacttgccaaacgaactt
attgaactgttggagaagattgtccttcaaaacacagcctttagtagcaaccccaattta
caaaacctcttgattttaactgccgtgaaaactgaaaaatcacgagtgatggattacatc
caccgtttggagaactttgatggtccagctgttggagagattgctgttggagcccagctg
tacgaggaagcgtttatgatcttcaagaaatttaacttgaatgtgcaagctgtcaatgtc
cttctagacaatcttcacagcatagggcgagctgccgagtttgccgaacgtgtggaagta
gacgaggtgtggagccaagttggcaaagcacaactcagagacggtcccataagtgatgca
attgattcctttgttcgcgccaaagatgcttcccagttcactaatgtcataagagaagct
ggaaagctcaaagcttatgataatctagtgcgttatttgattatggtgcgccagaaggtt
aaggagccacaggtagattcggcgctaatctttgcctatgctaaaatgagtcgccttgac
gatcttacagaaattgtcgcacaacccaatggctgtgtagcaaatctactcgtggttggg
gaccgtctctttaatgaagagctttatcaagctgccaaggttgtcttctctcacattggg
aattggcctcgtcttaccagcactctggtgaagttatatcagttccaagctgcaatcgaa
gttgctcataaagcaaatagctctaaaacatggagggaagtttgttttgcttgcgtggat
accgaggaatttcggttggctcaaatttgtggccttaagatcattattcaggtggatctt
ttggaagaggttagcgaatactaccagaataagggcaacttcgatgagctcataatgttg
atggaaagtggaattggtctggaacgggctcacatggggatatttacggagcttggaatt
ttatatgcgaaataccgtccagagaagctcatggaacatctaaatctcttctctacccgc
attaatattcccaagcttcttcgtatctgtgacgagcatcaccactggaaggagctttcc
tacttatacatccaatatgaagagtatgacaatgcagcagcaaccatcatgggtcattct
cccgacgcctgggatcatattcagtttaaggatgtggttagcaaggtggctaacgtagaa
ttgtactacaaagctatccagttctatctgcaagagcatccagaaattctcaacgacctt
ctcgctgttttggtaacccgtgttgatcacagccgtgcagtggatatcatgaggaaggca
ggacatttgcctctggtgaagccgtatatgcaagctgttcaaaattgcaacttgagtgct
gtgaatgaagctctcaatgagctctacatcgaagaagaggactatgaaatgattagagag
tccatcgacacttatgataattttgatccaattgccatggcacagcgtatcgagaatcat
gaacttctggaaatgcgaagaattgctgcttacatatataagaaggctgggaggtggcag
caatcagtagctctttccaaaaaggataaccttttttcggatgccatggagaccacgtca
cagtctggcgacagtgtatttgtagaagagttgctaactttctttgtcaaagagggcaag
aaagagtgttttgccgcatgcctgtacacctgttatgatctcattcaagctgatgtggtg
atagagttggcttggatgaacaatatgatggatttcgcctaccctttcctgctccagtac
ctccgagagtactctttgaaggttgctcatctcatgagctacaagaaccaggatgatgtg
catgggaaactcgaccacaatttggtagcagattcgaatatgtatgcgcagcttttacct
ttggctttgccggccccaccaattgttgcggctagtgggacatttgacgcttatgcaggg
ttgccggcttacggtttgttgcagtctagaggtagcacatcaccaacctactga

DBGET integrated database retrieval system