KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_148151Help
Entry
PHYPADRAFT_148151 CDS       T01041                                 

Gene name
SRT1501
Definition
class IV sirtuin
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     PHYPADRAFT_148151 (SRT1501)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 384 aa AA seqDB search
MSSLGYAEKLSYRADVGTVGMPELYDPAEDLQSKIDKLAQLISESRHLVAFTGAGISTSC
GIPDFRGPKGIWTLQHEGKPMPKIEMPFDQARPGVTHMALFELQQAGILKFIISQQNIDG
LHLRSGIPRSQLAELHGNCFREICSSCDKEYFRDFEVETLGCKPTGRRCTEHDCGGKLVD
TIVDWEDALPPAELRAAEKHTKKADLVLCLGTSLQITPACNLPLKTVRAGGKMVIVNLQA
TPKDKSAALLVRGRVDEVISGIMSRLHRTIPPYVHIDRILLSYYYYWTKKKSVKWYFRIS
SIHGQKMALPFIKSIEVMFPNRPEFKPAAFAKPPCLVRRETMRLKELDVALKLHFAEGCM
CSSGDIFQTLSFEVRDNYLLCRID
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcttggatatgccgagaagttgtcgtatagggctgatgttggtacagtggga
atgccagagctctatgacccagccgaagatcttcaatccaagatcgataagctggcccaa
cttatatcggagagtcgtcatttggtagcgttcactggagccggcatttcgacctcctgt
ggaatccccgatttccggggccctaaaggcatctggactttgcagcatgaaggaaagccc
atgccgaaaattgagatgcccttcgatcaggctcgaccaggcgttactcatatggctctt
tttgagcttcagcaagctggaatactcaagttcattattagccagcagaatatagatggg
ttacatttacgatctggaattccgaggtcgcaattggctgagcttcacggcaactgcttt
cgcgaaatatgttcttcctgcgacaaagagtattttcgagacttcgaggtggaaactcta
ggatgtaaaccaactgggcgccgctgtacggaacacgattgtggagggaaactcgttgat
acaattgtagactgggaggatgcgctgcctcctgctgaattgagggcggcagaaaagcat
acaaagaaggctgacttggtgttgtgtcttggcacaagcttgcagatcacccctgcgtgt
aatcttcctttgaaaactgtgcgagcaggtggtaaaatggttattgtcaatctgcaggca
actccaaaagacaagagtgcagctttgctggtccgaggacgggttgatgaggtaatatca
ggaataatgagccgcctgcatcggaccattccaccatacgttcatattgaccgcattcta
cttagctactactattactggacaaagaagaagagtgtgaaatggtactttcggatttca
agcattcatgggcaaaaaatggctttaccttttatcaaatcaattgaggtaatgtttcca
aacaggccagagttcaagccagccgcgttcgccaaacctccatgcctcgttcgcagggag
accatgcggctgaaagaactggatgttgcattgaaattgcactttgcggagggctgtatg
tgttccagtggcgacatttttcaaacgttgtcgtttgaggtacgtgacaactatttgtta
tgtcgaattgattag

DBGET integrated database retrieval system