KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_150121Help
Entry
PHYPADRAFT_150121 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 408 aa AA seqDB search
MTSDPVGCSYASAPIPLAPPAPLTPVSLRRSGWVGSSALSANRGPSSRRIPRGLKGTRSS
PNSSRPTSPRSYGEGDGYNSADEQSPWTPGTSGYEDCMERERQFVIELRRVKGLEVRHMA
EDGNCLFRAVADRVYGDAEMYDETRQMCIDYMEKERDHFSQFVTESFTAYCKRKRRDKVY
GNNLEIQAMAEIYNRPIHIYSYSAEPINIFHGSYETDLPPIRLSYHRGNHYNAIVDPCNP
AVGAGLGFGSLRGRNVDTEQVKAALNAQQELQIDKVLLAEGRYYSDMELTEQEIERMVIE
ESRAEYLAGEHLGSPRNSSDVMVSGQGSNRRPASRSPSLPATSTPSESSVLPENVRMLLS
MGFSYLRVMEAYSIFGDNINDMLCYLLETEPHSSGVGENIRRKGKAAE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagaccctgttggatgttcatatgcttcagcacctatccctctagccccgcca
gcccccttaacacctgtttcattacgaagaagtggttgggtgggaagctccgccttaagt
gcgaatcgagggccttcttctcgtaggattccgcgaggtttgaagggcacccgcagttct
ccaaacagctctcggcccacgtctcctcggtcttacggagaaggagatggctacaacagt
gctgacgaacaaagtccctggactcctggcacctccggctatgaggactgtatggaaaga
gaacgtcagtttgtgatcgagcttcgtcgtgtgaaaggacttgaagtcaggcacatggcg
gaggatgggaactgcctcttcagagctgtagcagatcgtgtgtatggagacgctgagatg
tatgatgagactcggcagatgtgcattgactacatggagaaagagagggatcacttctct
caatttgtgaccgagagcttcacagcttattgcaaaagaaagcgcagggataaggtatat
gggaataatttggaaatacaagcaatggcggagatttataatcggcccattcacatctat
tcatatagtgcagaacccataaatatctttcatggaagctatgagaccgatttacctcct
atacgcttgagctatcatcgtgggaaccactataatgctatcgtcgatccatgcaatcca
gctgttggagcagggcttggtttcggtagtttgcgagggcgaaatgtagacactgaacag
gtgaaggccgcgcttaacgcccagcaagagttacagatagacaaggttctacttgcagaa
gggcggtactattctgacatggaattaaccgagcaagagatagaacgcatggtgatcgaa
gaatcccgtgcggagtacttggcaggggaacatcttggtagtcccagaaactcgagcgat
gtgatggtttctggacaaggttccaacagacgacccgcctcacgttctcctagccttcca
gcgacctctacgccaagtgaaagtagtgtgctgccagagaacgttcgaatgctgctctct
atgggattcagctatttgcgagtaatggaagcctacagcatctttggggacaacatcaat
gacatgctgtgctatttattagagactgaacctcatagctctggcgttggggaaaacata
agaagaaaggggaaagctgctgaatga

DBGET integrated database retrieval system