KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_150213Help
Entry
PHYPADRAFT_150213 CDS       T01041                                 

Gene name
HDA1510
Definition
class II RPD3 type histone deacetylase protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 535 aa AA seqDB search
MGANSPAEGELDHVSGENAVKDVFQEKGKEVEKDVHPLAAFLALHGIDGAEDDDEMESED
EEWQPHVRWICTNCIMPNPEDEVYCWKCNEHRNSSILEQGFMSLISLILFFNDAGTFMCG
KEKKTAIGYDDRMLLHEETGKSHPERPDRLRAIMGGLQASGLLSGTCFTIPAREATQAEL
ELVHTANHIGAVQATEGQDLSYFTPDTYANEHSALAARLAAGICTDLASAIMTGKAHNGF
AAVRPPGHHAEQEQVMGFCLHNNACVAARAAQAAGAKKVLIVDWDVHHGNGTQEIFEQDP
TVLYISLHRHEAGAFYPGTGWAHQVGSGPGEGFCVNIPWSCGGIGDGDYLSAFQHVVMPI
ARQFEPDMTIISAGFDAARGDPLGGCDVTPEGYAQMTFLLSSLSGGRILVVLEGGYNLRS
ISASAAAVMKVLQGTNPGPLPDDLQPTPVGAAAMLELFMIQRRYWSNLHDATFLKFGALL
DSWSKAGERKSSKRRHIGGPIWWKWGRKRVLYDIWLRGQMKHHSSSRHDHSCPCC
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgaacagccctgcagagggcgagctggatcacgtttcaggtgaaaatgctgtc
aaagatgtgttccaggaaaaggggaaagaggtggagaaggatgtgcacccgctagcagca
tttcttgcattgcatgggattgatggtgcggaagatgatgatgagatggaatcagaagat
gaagaatggcaacctcatgtgcgttggatttgtacaaactgcatcatgccgaatcctgag
gatgaggtctactgctggaagtgtaatgaacatcgcaattcaagtattttggagcaaggg
tttatgtctttgatatcattaattctcttcttcaacgatgcagggactttcatgtgtggt
aaagaaaaaaagaccgctattggttacgatgatagaatgttgttacatgaagaaactgga
aaatcacatcctgagcgtccagataggttacgagctatcatgggaggcctgcaagcttct
ggcttgctttccggaacttgctttacgatacccgccagagaagccactcaagcagagttg
gaacttgttcatactgccaatcatataggtgcagtgcaagccacagaaggacaggactta
agttacttcacccctgacacgtatgccaatgagcactctgctttagcggcacgattagca
gccggaatttgcacagatttagcatcagctatcatgactggaaaggcccacaatggtttc
gcagcagttaggccacctgggcatcatgctgaacaagaacaagtcatgggcttttgcttg
cataacaatgcatgcgtcgctgctcgagctgcacaggctgctggggcgaagaaggtttta
attgttgattgggatgtacatcatgggaatgggacacaagagatttttgaacaagatcca
acagtgctgtatatttctcttcatcggcacgaagctggtgcgttctatcctggaacgggt
tgggcacatcaagtggggagtggccctggtgaagggttttgtgttaacataccatggagt
tgtggtggaattggggacggagattacctgtcagcatttcaacatgtggtcatgccaatt
gctcgtcaattcgaacctgatatgacaatcatctcagctggttttgatgctgcaaggggg
gatcctcttggaggttgtgatgtaactcctgagggctatgcacaaatgacctttctctta
agctctctgtcaggtggtcggatccttgttgttttggaaggaggttataatttgcggtct
atttctgcctctgctgctgctgttatgaaggttctacaaggtacaaaccctggtccattg
ccagatgatctccagccaactcctgtgggggcagcagccatgttggagttgtttatgatt
caacgacgctactggtcaaacttacatgatgcgacttttttgaagtttggtgctcttttg
gacagttggtccaaagctggtgagaggaagagctccaaaaggcgacacattggagggcca
atttggtggaaatggggtcggaaaagggtattgtatgacatctggttaagaggccagatg
aagcatcactctagttcaaggcatgatcactcatgtccttgttgttag

DBGET integrated database retrieval system