KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_151163Help
Entry
PHYPADRAFT_151163 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_151163
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHYPADRAFT_151163
Enzymes [BR:ppp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PHYPADRAFT_151163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 336 aa AA seqDB search
MRNTQGITIRRRPATGPPIHNVGPFQFKIQSEGNTPRNILEEIVWHKDVEVAQVSYQFLS
SYLEILRCSLLQMKEKTPLGALSKLMAGVGPTRDFVGALRARAAETGYPALIAEVKKASP
SRGVIQPNFDPVRIAQGYEKGGATCLSVLTDSKYFQGGFENLRLIRNAGVQCPLLCKEFI
IDAWQIYKARVSGADAVLLIAAVLPDQDLAYMTKIAKALGMAALIEVHSEREMKRVLGLP
NVELIGINNRSLETFKVDINNTVELLKGDIGTQIRERNIIVVGESGLFTPEDIALVRNAG
VGAVLVGESLVKQDDPGAGIAKLFGEDISRKQTSVA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacactcagggtattaccatcaggcgccgacccgcaacaggcccgcctattcac
aacgtcggtcctttccaattcaagattcagagcgaaggcaacacccctcgcaacatcttg
gaggaaatcgtctggcacaaggatgtggaagttgctcaggtatcataccaattcctttcg
tcatatcttgagatcttgagatgttcgcttttgcagatgaaggagaagaccccgcttgga
gctttgtcgaagttaatggcaggagtagggcctacaagggactttgtgggagcgcttaga
gcgagggcggcagagactgggtacccagcattgattgctgaagtgaagaaagcgtcacca
agtcgcggtgttatccagcctaactttgatccagtacgaattgcgcaagggtatgaaaag
ggtggagctacttgtttgagtgtattgacggattccaaatatttccaaggaggatttgag
aacttgagactaatcaggaatgctggggtccaatgcccgcttttgtgcaaagaattcatc
attgatgcgtggcaaatctacaaggcccgtgttagcggtgcagatgctgtcctcttaata
gcagcagtgctgcctgatcaggatcttgcttacatgaccaaaatcgcgaaggccctgggc
atggctgctctcatcgaggtacacagtgagcgcgagatgaaacgtgttttgggtttgcct
aatgtggagcttattggcatcaataatcgcagtttggaaacttttaaggtggacatcaat
aatacagtagagctcttgaaaggagatattggaactcagattcgtgaaagaaatatcatt
gtagttggagaatcaggattgtttacaccagaggatattgctttggttcgtaacgcaggc
gttggtgcggttcttgtgggggagtctttggtgaagcaagacgatcctggtgcaggcatt
gctaagctgtttggggaggacatatccaggaaacagacttctgtggcttag

DBGET integrated database retrieval system