KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_153778Help
Entry
PHYPADRAFT_153778 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PHYPADRAFT_153778
Protein kinases [BR:ppp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   PHYPADRAFT_153778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 426 aa AA seqDB search
MTQLAYKLTKDIVATYQNCNPDFAFSPDLNPKRYLTAPSTIVSESGLDNEKHDLVLYFHQ
VLVNNDGTRRYVVKDLVGSGTFGQVAKCYTEETNEYVAVKVIKNLPAYHTQARFEIGILH
MLNNEYDPDDKYHIVRSLDHFQYHGHLCIVFELLTENLYELLKKTNLKGMSLVLVRMFTK
QLLKSLSLLREARVIHCDLKPENILLIESFRSADLKLIDFGSACKEDQTVYTYIQSRFYR
SPEVLLGHRYTTAIDMWSLGCVAAELFLGLPLFPGACDFDMLLFMKEKLDQPPDHILRNA
KYTNKFFKLLTAAPHADHNRSAYQLLTVEEYGARHKKKPEIGRRYFHGTLSEMIMGFHMK
PMSVAEQNRELRARESFIDFLKGLIECDPRKRWSPQQAAQHPFVTDEPFIGPYVPVPETP
RTVTAA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagttggcatacaaacttacgaaggatattgtcgcgacttatcaaaactgcaac
cccgattttgcgttttcaccggatctgaacccgaagcggtatcttactgctccatcgaca
atcgtttctgagagcggcttggataatgaaaaacacgaccttgtgctgtatttccatcag
gtcttggtgaacaacgacggtactcgaaggtacgttgtgaaagatctggtaggttcgggc
acgttcgggcaggtagcaaaatgttatacggaggagacgaatgagtacgttgcggtgaag
gtgataaagaatcttccagcttaccacacccaagcgcggtttgagatcgggattttacac
atgctgaacaacgaatacgatccagatgacaagtaccacattgtcaggagtctagaccac
tttcagtaccacgggcatctgtgcattgtgtttgagcttcttacagagaatttgtacgag
ttattgaagaagacgaatttgaagggcatgtcgcttgtcttggtgcggatgttcactaag
cagttgctgaaatctctcagtctgctgcgggaagctagagtgatacattgtgatttgaaa
ccggagaacattcttttgattgagagttttcgatcggcggatttaaagcttatcgatttc
gggtcagcgtgtaaggaagaccagacagtctacacttacatacagagtcggttttacagg
tcccccgaggtactgcttggtcaccggtacacgaccgctattgatatgtggtcgttaggg
tgtgtggcggctgagcttttcttggggctgccactgttccctggagcatgcgactttgac
atgctgttattcatgaaggagaaactcgaccaaccgccggatcatatcttgaggaacgcg
aagtacacgaacaagttctttaagctattgacagctgcccctcatgctgatcacaatcgc
agcgcttaccagctgctgacagtagaagaatatggagcgcgtcataagaagaaaccagag
attgggaggaggtacttccatggcactctttcggaaatgataatgggatttcacatgaag
cccatgtcagtggctgaacaaaacagagaattgcgagctcgggagagctttatagacttt
ctcaagggcttgatcgaatgtgacccaaggaaaagatggtcacctcagcaggccgcacag
cacccattcgtgacagatgaaccgtttattggaccttacgttcctgttccagagactcca
cggacggtaactgctgcgtaa

DBGET integrated database retrieval system