KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_15419Help
Entry
PHYPADRAFT_15419  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PHYPADRAFT_15419
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PHYPADRAFT_15419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 309 aa AA seqDB search
PLVVVGSVNADIYVEVERLPVEGETIAARSGQTLPGGKGANQAACAARLSYPTFFCGQVG
LDGHANLVKDALASAGVRLDHVNTVDSPTGHAVVMLQPGGKNSIIIVGGANVAWPKLEDG
ISRLTANAQQLIKRAGAVLLQREIPDAVNLEAAKVAKSAGVPVIMDAGGAEGPIPEELLK
HVTVLSPNESELARLTAMPTNSLEKILLAAAKVQEMGVQQVLVKMGETGSVLVSGKEPPI
YQPAILAPTVVDTTGAGDTFTASYAVALIERQTPAEALRFAAAAASICVRSKGAMPSMPE
RKAVLQLLK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
cctttggtcgtagtcggatcggtgaatgctgacatttatgtggaggttgagcggcttccg
gtcgagggtgaaaccattgctgctagaagtggccagactcttcctggtggaaagggcgct
aatcaagctgcttgtgcggctcgtctttcctaccctactttcttctgtggtcaggttgga
ctggacggccatgccaacctggttaaagatgccctcgcatctgctggagttcgtctagat
catgtgaacacggtcgactctccgactggtcatgcagttgttatgttacaaccaggaggg
aaaaactcaattatcatcgtcggaggagctaatgtcgcatggcctaagttagaagacggt
atcagcagattaacagctaatgcgcagcagttgatcaagcgagcaggtgcagtgcttctg
caacgtgaaattccagacgcagtcaatctggaagctgctaaggttgcaaaaagtgctggt
gttcccgtgataatggatgccggaggtgcggaaggtcctattccagaagagcttctgaaa
catgttacggtgctgagccctaacgagtcggagttggctcggctaactgcaatgccaacc
aattctttagagaaaattcttctagcagctgccaaggttcaagagatgggtgtccagcaa
gtattggtcaagatgggagagaccggctccgttcttgtgtctggtaaggagcctccaatt
tatcagcccgctatcctggctccaacggtagttgatacaactggtgctggtgacactttt
acagcttcttacgctgttgctctaatcgagcgtcaaacaccagcagaagcgcttaggttt
gctgctgcagcagcttccatctgtgtgcggtccaaaggtgcaatgccaagcatgcctgaa
cggaaggcagttcttcagctcttgaag

DBGET integrated database retrieval system