KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_15475Help
Entry
PHYPADRAFT_15475  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PHYPADRAFT_15475
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PHYPADRAFT_15475
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PHYPADRAFT_15475
Lipid biosynthesis proteins [BR:ppp01004]
 Desaturase
  First
   PHYPADRAFT_15475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 292 aa AA seqDB search
KIWLSDVVVKRRRNYFKNRQWTSKDLTYAGFMIFMHGLCLFAPATFSWEAVGVFMGLYVI
TGMLGITLSYHRNLSHKSFKVPKWLEYTFAYCGVQAVQQGDPTEWVSAHRYHHQHCDTEN
DPHTPYEGFWHSHMGWLLDDAQTQERVGARNNVSDMEKDPFYNFIEKTYPIHPMLLAAAL
YAVGGFPYIVWGMAVRTVWVYHITWFVNSASHVWGSQKWNTGDLSRNNWWVALLAFGEGW
HNNHHAFEYSARHGLEWWQLDPTWWVIRGLEAVGLATKVKLPRKDHMEKLAF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
aagatttggctgtcggatgtggtggtgaagaggcgcaggaactacttcaagaacaggcaa
tggacgtcgaaggacctgacgtacgcggggttcatgatcttcatgcacgggctgtgcttg
ttcgcgccagcgacgttctcatgggaggcggtgggcgtgttcatgggattgtatgtgatc
acggggatgctggggatcactctgtcgtatcaccggaacctgtcgcacaagagcttcaag
gtgccgaagtggttggagtacacgttcgcgtattgcggagtgcaagccgtgcagcagggt
gacccaacggagtgggtgagcgctcaccggtatcaccaccagcattgcgacacggagaac
gatccgcacacgccgtatgaggggttctggcacagccacatggggtggctgctggacgac
gcccaaacacaagaaagggtgggcgcgaggaacaacgtgtcggacatggagaaggacccg
ttctacaacttcatagagaagacgtatccaattcacccgatgctactggcagcagcgttg
tatgccgtgggaggatttccttacatcgtgtggggcatggctgtgaggacggtgtgggtg
tatcacatcacatggtttgtgaactctgcatcgcatgtgtggggatcgcagaagtggaac
acgggagacttgtctcggaacaactggtgggtggcattgctggcatttggggaagggtgg
cacaacaaccaccacgcattcgaatactcagctcggcatggcctggaatggtggcagttg
gacccgacatggtgggtgatccgggggttagaagccgtgggtctggccacgaaagtgaag
ctaccgaggaaggatcacatggagaagctggcattc

DBGET integrated database retrieval system