KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_158740Help
Entry
PHYPADRAFT_158740 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 371 aa AA seqDB search
MGASSSKLEKVLGDQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLEYCGQKKP
VAESEENLLTCLSELFTQINSQKKKTGVIAPKRFVQRVRKQNELFRSYMHQDAHEFLNFL
LNELVDILVKEAQAANSNSGSHTSPEKVVGNGATNGLANGNHKEPVVTWVHKIFQGTLTN
ETRCLRCETITARDETFLDLSLDIEQNSSITSCLRNFSSTETLNAEDKFFCDKCCSLQEA
QKRMKIKSPPRILALHLKRFKYIEQLGRYKKLSYRVVFPLELKLCNTTDDAPGSEAEYSL
FAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEIIDESIVQTFFGSTQEYSNNTDHGY
ILFYESLDQKK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggagcctcgagttcgaagctggagaaggtattgggagaccagtttccagagggagaa
cgatactttgggctggagaatttcggcaacacctgctattgcaatagtgttttgcaggct
ctgtacttctgcgttccattcagggaacaacttttggagtactgtggtcagaagaaacct
gttgcggaatcagaagagaatctgctgacttgcttgtcagagctcttcacacagataaac
tcacagaagaagaagactggtgtgattgccccgaagcgttttgttcaaagggtgaggaag
cagaatgagctatttcggagttacatgcaccaggatgctcacgagtttctgaactttctg
ctgaatgagctagttgacatcttggtaaaggaggcacaagcggctaattcaaattcaggc
tctcatacatccccagagaaggtggtgggcaacggggcaacgaatggattggcgaatggg
aatcacaaggaaccagttgttacctgggtgcacaagatttttcagggtacgctgacaaat
gaaaccagatgcttacggtgtgaaactatcaccgcgcgagatgagacgttcttagatctg
agccttgacattgagcagaacagttctatcacgagctgcctgcggaatttcagttccaca
gaaacactcaacgcggaggacaagtttttttgtgataaatgttgcagtttgcaggaggct
cagaagaggatgaaaatcaagtcaccgcctcgcattctagcactccacctgaagcggttc
aagtacatcgagcagttggggcgttataagaagctgtcgtaccgtgtagtgttcccactg
gaattgaagctttgcaacacgacggacgatgcacctgggtcggaggcagaatattcgttg
tttgctgtggtggtgcatgttgggagtggaccaaatcatggtcattacgtgagtctggtg
aagagtcataaccactggctttttttcgacgatgagaatgtggagatcattgacgagtcc
atagttcagacattttttggatccactcaggaatattctaacaatacagatcatggatac
attttgttctacgagagtttggatcagaagaagtag

DBGET integrated database retrieval system