KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_159836Help
Entry
PHYPADRAFT_159836 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_159836
  Amino acid metabolism
   00340 Histidine metabolism
    PHYPADRAFT_159836
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PHYPADRAFT_159836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 434 aa AA seqDB search
MKVYKLSELNTDQVEGLRARPRIDFTSIFETVGPIVENIRRRGDVAVKEYTSRFDQVDLE
SVVVNVADLPDPVLDPEVKAAFDVAYENIKCFHAAQQRNQHLQVETMPGVNCRRVPRAIN
NVGLYVPGGTAVLPSTTLMLAVPAQIAGCKTVVVATPPRKDGSICPEVLYCAKKSGVKFI
LKAGGAQAISAMAWGTETCPKVDKVLGPGNQYVTAAKMLLQNSEAMVAIDMPAGPSEVLV
IADKLASPVHVAADLLSQAEHGPDSQVVLVAASDEVDIAAIQHEVERQCRDLPRDIIATK
ALSHSHIVVAKDMAEACEFSNMYAPEHLIVNVEDAEQWLNSLDNAGSIFLGRWTPESVGD
YASGTNHVLPTYGYARMYGGVSLNSFVKYITVQSLTADGLQKLGPFVAKMAEVEGLEAHK
RAVTFRLCDINASS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtataaactatctgaacttaatactgaccaagttgaaggtcttcgagctcgc
cctcgtatcgacttcacttcaatctttgaaacggttggccctattgtggagaacattcga
cgacgtggagacgtggctgtgaaagaatatacaagccggtttgatcaagtagatcttgaa
agtgtagtcgtcaacgttgcagatctacctgatcccgtgcttgaccctgaggtaaaagca
gcattcgacgtagcttatgagaatatcaagtgtttccatgctgcccagcagaggaaccaa
catcttcaagtggagactatgccgggcgtaaattgcaggagagtccctagggctatcaac
aatgttggtctttacgttcccggaggcactgcagtccttccatcgactactctcatgttg
gctgtacctgcacagatcgctgggtgtaagaccgtggtcgttgcaactcctccaaggaaa
gacggctctatttgtcccgaagtactgtactgtgctaagaagtcaggtgtgaagttcatt
ctgaaagctggtggagctcaggcgatttcagcaatggcttggggtactgagacatgtcca
aaggtcgataaagttcttggacctggaaatcagtatgttacggctgcgaagatgttgttg
cagaatagtgaagcaatggtagctatcgatatgcccgctggtccgtcggaggttcttgtg
attgccgataagcttgcttctcctgtccacgtggctgcagatttgctttctcaggcagaa
catgggccagatagtcaggtggttcttgtagcagcaagtgatgaagtagacatcgctgcc
atacagcacgaggtggagagacaatgtagggatttacctagggacataatcgctaccaaa
gctctttctcacagccacattgttgttgcgaaggacatggcagaggcatgtgaattttcg
aacatgtatgctcctgagcacttgattgttaacgtggaggacgcagagcagtggttgaac
tctctagataatgcaggatccatatttttgggaagatggacacctgagagcgtgggtgac
tacgccagtggaactaaccatgtgttgccaacatatggctacgctcggatgtatgggggc
gtgtctctgaactcttttgttaaatatattactgtgcagtccttaacggcagacggtctg
caaaagctagggccgtttgtcgctaaaatggctgaagttgagggtctagaggcacataag
agggcagtgacatttcggctgtgtgatattaatgcctcgagttaa

DBGET integrated database retrieval system