KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_159836Help
Entry
PHYPADRAFT_159836 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ppp00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 434 aa AA seqDB search
MKVYKLSELNTDQVEGLRARPRIDFTSIFETVGPIVENIRRRGDVAVKEYTSRFDQVDLE
SVVVNVADLPDPVLDPEVKAAFDVAYENIKCFHAAQQRNQHLQVETMPGVNCRRVPRAIN
NVGLYVPGGTAVLPSTTLMLAVPAQIAGCKTVVVATPPRKDGSICPEVLYCAKKSGVKFI
LKAGGAQAISAMAWGTETCPKVDKVLGPGNQYVTAAKMLLQNSEAMVAIDMPAGPSEVLV
IADKLASPVHVAADLLSQAEHGPDSQVVLVAASDEVDIAAIQHEVERQCRDLPRDIIATK
ALSHSHIVVAKDMAEACEFSNMYAPEHLIVNVEDAEQWLNSLDNAGSIFLGRWTPESVGD
YASGTNHVLPTYGYARMYGGVSLNSFVKYITVQSLTADGLQKLGPFVAKMAEVEGLEAHK
RAVTFRLCDINASS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtataaactatctgaacttaatactgaccaagttgaaggtcttcgagctcgc
cctcgtatcgacttcacttcaatctttgaaacggttggccctattgtggagaacattcga
cgacgtggagacgtggctgtgaaagaatatacaagccggtttgatcaagtagatcttgaa
agtgtagtcgtcaacgttgcagatctacctgatcccgtgcttgaccctgaggtaaaagca
gcattcgacgtagcttatgagaatatcaagtgtttccatgctgcccagcagaggaaccaa
catcttcaagtggagactatgccgggcgtaaattgcaggagagtccctagggctatcaac
aatgttggtctttacgttcccggaggcactgcagtccttccatcgactactctcatgttg
gctgtacctgcacagatcgctgggtgtaagaccgtggtcgttgcaactcctccaaggaaa
gacggctctatttgtcccgaagtactgtactgtgctaagaagtcaggtgtgaagttcatt
ctgaaagctggtggagctcaggcgatttcagcaatggcttggggtactgagacatgtcca
aaggtcgataaagttcttggacctggaaatcagtatgttacggctgcgaagatgttgttg
cagaatagtgaagcaatggtagctatcgatatgcccgctggtccgtcggaggttcttgtg
attgccgataagcttgcttctcctgtccacgtggctgcagatttgctttctcaggcagaa
catgggccagatagtcaggtggttcttgtagcagcaagtgatgaagtagacatcgctgcc
atacagcacgaggtggagagacaatgtagggatttacctagggacataatcgctaccaaa
gctctttctcacagccacattgttgttgcgaaggacatggcagaggcatgtgaattttcg
aacatgtatgctcctgagcacttgattgttaacgtggaggacgcagagcagtggttgaac
tctctagataatgcaggatccatatttttgggaagatggacacctgagagcgtgggtgac
tacgccagtggaactaaccatgtgttgccaacatatggctacgctcggatgtatgggggc
gtgtctctgaactcttttgttaaatatattactgtgcagtccttaacggcagacggtctg
caaaagctagggccgtttgtcgctaaaatggctgaagttgagggtctagaggcacataag
agggcagtgacatttcggctgtgtgatattaatgcctcgagttaa

DBGET integrated database retrieval system