KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_160451Help
Entry
PHYPADRAFT_160451 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ppp03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 324 aa AA seqDB search
MDSAVLDDIIVRLLEVRTGRPGKQVQLSEAEIRQLCVASKDIFLSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG
NHECASINRIYGFYDECKRRFNIRLWKTFTDCFNCLPVAALIDEKILCMHGGLSPELKNL
DQIKKIARPTDVPDAGLLCDLLWADPDKDVASWGDNDRGVSYTFGPDTVSEFLQKHDLDL
ICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPAEKKQ
KFVSYGNNVSRPRTPPRAVQVSRF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgcggtattagatgatattatagtgcggctgctcgaggtacggactgggcgg
ccgggcaagcaagtgcagctttcggaggccgaaatccgtcagctttgtgtcgcgtcaaag
gatatatttttgtcccagcctaaccttcttgagcttgaggcgccaatcaagatctgtggt
gatatccatggacagtattccgacctcttgagactgttcgaatatggtggctttcccccc
gaggcaaattacttgtttttaggggattatgtggacagagggaagcagagtctagaaacc
atctgcctcctcttggcatataaaatcaagtacccagagaacttctttttgctaagaggt
aatcatgaatgtgcatcaatcaaccgaatatacggcttctacgatgaatgcaaacgccgt
ttcaacatacggttgtggaagacgtttacagattgcttcaactgcttgcccgtggctgcc
ttgattgatgaaaagattctctgcatgcatggaggcctctctccagagctcaagaacttg
gatcaaattaagaagattgcacggccaacggacgtgcctgatgcaggcttgttgtgtgac
cttttatgggcggatcctgacaaagatgtagcgagctggggagataatgaccgaggagtt
tcctacacatttggtccagatacggtctctgagtttctccaaaaacatgacttggatctt
atctgccgagcccatcaagtagtggaggatggttatgagttttttgctaaacgccagctg
gtcactattttctctgcaccaaattactgtggtgaatttgataatgcgggtgcgatgatg
agtgtggatgatactctcatgtgctcgtttcagattttgaaaccggcagaaaagaaacaa
aagttcgtctcctatggcaataatgtatcacgacctagaacaccgcctcgggcagtccag
gtcagcagattttga

DBGET integrated database retrieval system