KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_161474Help
Entry
PHYPADRAFT_161474 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PHYPADRAFT_161474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 347 aa AA seqDB search
MASFGTLSSTQPHNPNKSFEVNQPPTDGISSLAFSPKANYLVATSWDNQVRCWEIQSNGS
SVPKAAISHESPVLCSAWKEDGSTVFSGGCDKQAKMWPILSGGQAVTVGMHDAPIKSISW
ISEMNLLVTGSWDKTLKYWDLRAQTPAHTQQLPERCYAMSVRHPLMVVATADRNIVVYNL
ASPQTEFKRIQSPLKYQTRCVATFPGKEGFLVGSIEGRVAVQHIDDAQQSKNFTFKCHRD
NNDIYAVNSIDFHPVHGTFATSGSDGAFNFWDKDSKQRLKAMQRCNQPIPCSTFNHDGTI
FAYGVSYDWSKGAENHNPSQARNYILLHPTQDSEVKAKARVAASGRK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccagtttcggtaccctatcttcgacgcaaccgcacaatccgaacaaatcatttgag
gtcaatcaacctccaactgatggtatttcgagtcttgccttcagtccaaaggcgaactat
ctggttgccacctcatgggataatcaggtgaggtgctgggagattcagtcaaatggcagc
agtgttcctaaagcagctatttcacatgaatcgcctgtcttatgctctgcctggaaggag
gatggaagtacagtgttctcaggaggttgtgacaagcaagcaaaaatgtggcccatacta
tctggtggccaggcagttaccgtaggcatgcatgatgcacctattaaaagcatttcgtgg
atctctgagatgaatctccttgttactggaagctgggacaaaactctgaaatattgggat
ttacgggcacaaactccagcccatactcaacaacttcctgagcgatgttatgctatgagt
gtccggcatccgctcatggtggtagcaactgcggatagaaacatagttgtctacaatctt
gcaagcccacaaacagaatttaagcggatacagtcgccattaaagtatcaaacacgatgt
gtggcaaccttcccgggcaaggagggcttccttgttgggtcaatcgagggaagagtggcc
gttcagcacattgatgatgctcagcaatcaaagaacttcacttttaaatgccatagagat
aacaacgatatatatgcagtcaattctatcgacttccatcctgtacatggaacgtttgcc
acctctgggtctgatggagcatttaatttttgggacaaggacagcaaacaaagacttaag
gcaatgcagcgctgcaatcaaccgatcccttgcagcacattcaaccacgatggaaccata
ttcgcttacggggtgagctatgactggagcaagggtgctgagaatcataacccatcacaa
gctcgcaactacatccttctccatcccacgcaggactctgaagttaaagcaaaagcacgg
gttgccgccagtggaaggaaataa

DBGET integrated database retrieval system