KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_161618Help
Entry
PHYPADRAFT_161618 CDS       T01041                                 

Gene name
HTB1503
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PHYPADRAFT_161618 (HTB1503)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 136 aa AA seqDB search
MAPKAGEEQKAGKSKAEKKPVVKKAEKKIKADTKGDAKKKKSKKSVETYKIYIYKVLKQV
HPDTGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPTITSREIQTAVRLILPGELAK
HAVSEGTKAVTKFTSA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaggcaggtgaggagcagaaggctggcaaatcgaaggccgaaaagaagccc
gtggtgaagaaggcggagaagaagattaaggccgacaccaagggcgatgcgaagaagaag
aagtctaagaagagtgtcgagacctacaagatttacatctacaaggtcttgaagcaggtg
caccctgataccggtatttcatcgaaggcgatgggtattatgaactcatttattaatgat
attttcgagaagctggcccaagaggctgctcgtctggcacggtacaataagaagccaacg
atcacttctcgcgagatccaaactgctgtgaggttaatattgccaggggaattggcgaag
cacgccgtgtcagaaggtacaaaggcggtgactaagtttactagcgcataa

DBGET integrated database retrieval system