KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_162107Help
Entry
PHYPADRAFT_162107 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  
translation initiation factor 4E
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PHYPADRAFT_162107
Messenger RNA biogenesis [BR:ppp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PHYPADRAFT_162107
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PHYPADRAFT_162107
Translation factors [BR:ppp03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PHYPADRAFT_162107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 220 aa AA seqDB search
MADELAAATEALRLDDSKGEELEEGEIVENPADRPAETKKHPLEHSWTFWFDNPNGKQKQ
ATWGSSLRSVYTFHTVEEFWCLYNNILQPSKLIAGADFHCFKSGIEPKWEDPKCAHGGKW
TAQPPRSGGKAVLDTYWLHTLLAMIGEQFDEGDEICGAVVSVRRAQDKIAIWTKTASNEA
AQVSIAKQWKDVLDYNDKIGYLVHEDAKRQDKNAKNRYTV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagttggcagcggcgaccgaagctttgagattggatgattccaagggcgag
gagctggaggagggggagattgttgagaaccccgcagatcgtcccgccgagacgaagaag
cacccgctggagcattcgtggacgttttggtttgacaatccgaacgggaaacagaagcag
gccacatgggggagctctctgcgttccgtctacacgtttcacactgttgaggaattttgg
tgcttgtacaacaacattttgcaacctagcaagctgattgctggggcagattttcactgc
ttcaagagcggaattgagcctaaatgggaggaccctaagtgtgcccatggtggcaaatgg
actgctcagccacccaggagcggcggcaaggctgtgcttgacacctactggcttcacaca
ttgctggctatgattggagagcaatttgatgaaggtgacgaaatttgtggagcagttgtc
agcgtgagacgagcgcaggacaaaatagctatctggactaagactgcctctaatgaggct
gctcaggtcagcatcgcgaagcaatggaaagatgttctggattacaatgacaagattggt
tacctagttcatgaggatgccaaaagacaagacaagaacgctaaaaacaggtatactgtt
tag

DBGET integrated database retrieval system