KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_162819Help
Entry
PHYPADRAFT_162819 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PHYPADRAFT_162819
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PHYPADRAFT_162819
Transfer RNA biogenesis [BR:ppp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PHYPADRAFT_162819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 371 aa AA seqDB search
MAAAIQAVQLACMLSQRVQERLLRNEEKARSKKDKSVVTVADWGVQAVVSWVLSQSFQGE
ELSMVAEEDTKGLRGQSGVDMSQRVVNAVNECLREASAVGIAPPKQPLRSYEVLKFINKG
TAPGGPTGRHWVLDPVDGTLGFVRGDQYAVALALVDDGQVVLGVLGCPNFPMRPAWLGYH
HKYYRMAMKIAPPDPSHWHRGCVMTAQKGEGRAWVQPMIFNGESFNEFHAPREVCVSSVV
DPVDATFCEPVERANSSHSFTSGLADTLGLRNQPLRVYSMAKYAAVARGDAEIFMKFAKA
GYKEKIWDHAAGVLIVQEAGGVVTDAGGRPLDFSKGRFLEGLDRGIVACCGKSLHNKIIA
AVDASYNSSTL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgctattcaagccgtccagcttgcctgcatgctgagccagcgtgttcaggag
cgtctacttcggaacgaggagaaggcaaggtctaagaaggacaagtctgtagttactgtg
gcagattggggagtgcaagctgttgtgagctgggttctctcacaatcttttcaaggggaa
gagttatcgatggtagctgaagaagatacgaaaggcctaaggggtcaaagtggcgtagac
atgtcacagagggtcgtcaatgctgtaaatgaatgcttacgtgaggcctccgcggtgggc
atagcgcctccaaagcaaccacttcgctcttacgaagtcctcaagttcataaacaaagga
accgcccctggtggtcctacagggcgtcactgggtgcttgatcctgtagatggtactttg
ggatttgttcgtggagaccaatatgcagttgccctggctcttgtagacgatggccaagtt
gtgcttggggttttaggatgtccaaattttccaatgaggccagcttggttgggatatcat
cacaaatactaccgaatggcaatgaagattgcacccccagaccctagccattggcaccgg
gggtgtgtcatgacagcccaaaaaggagaaggtcgagcatgggtgcagcccatgattttt
aatggagaatcattcaatgagtttcatgctcctcgtgaggtctgcgtgtcatcggtggtt
gatccggtagacgcaactttttgtgagccagttgagagagccaactcaagtcattctttt
acatctggtctggcggacactttgggtttgaggaatcaaccactgcgagtctacagcatg
gccaaatacgcagccgttgctcgaggggatgcagaaatcttcatgaagtttgcaaaagct
gggtacaaagagaaaatttgggatcatgcagcgggtgtgctcatagtccaagaagcgggc
ggtgtggtaactgacgcaggtggccgacctcttgacttctccaagggtcggtttctggaa
ggactggatcgtggcattgtagcttgctgtggaaagtccttgcacaacaaaatcattgca
gctgtggatgctagttacaattcgtctactctttga

DBGET integrated database retrieval system