KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_162819Help
Entry
PHYPADRAFT_162819 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ppp00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 371 aa AA seqDB search
MAAAIQAVQLACMLSQRVQERLLRNEEKARSKKDKSVVTVADWGVQAVVSWVLSQSFQGE
ELSMVAEEDTKGLRGQSGVDMSQRVVNAVNECLREASAVGIAPPKQPLRSYEVLKFINKG
TAPGGPTGRHWVLDPVDGTLGFVRGDQYAVALALVDDGQVVLGVLGCPNFPMRPAWLGYH
HKYYRMAMKIAPPDPSHWHRGCVMTAQKGEGRAWVQPMIFNGESFNEFHAPREVCVSSVV
DPVDATFCEPVERANSSHSFTSGLADTLGLRNQPLRVYSMAKYAAVARGDAEIFMKFAKA
GYKEKIWDHAAGVLIVQEAGGVVTDAGGRPLDFSKGRFLEGLDRGIVACCGKSLHNKIIA
AVDASYNSSTL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgctattcaagccgtccagcttgcctgcatgctgagccagcgtgttcaggag
cgtctacttcggaacgaggagaaggcaaggtctaagaaggacaagtctgtagttactgtg
gcagattggggagtgcaagctgttgtgagctgggttctctcacaatcttttcaaggggaa
gagttatcgatggtagctgaagaagatacgaaaggcctaaggggtcaaagtggcgtagac
atgtcacagagggtcgtcaatgctgtaaatgaatgcttacgtgaggcctccgcggtgggc
atagcgcctccaaagcaaccacttcgctcttacgaagtcctcaagttcataaacaaagga
accgcccctggtggtcctacagggcgtcactgggtgcttgatcctgtagatggtactttg
ggatttgttcgtggagaccaatatgcagttgccctggctcttgtagacgatggccaagtt
gtgcttggggttttaggatgtccaaattttccaatgaggccagcttggttgggatatcat
cacaaatactaccgaatggcaatgaagattgcacccccagaccctagccattggcaccgg
gggtgtgtcatgacagcccaaaaaggagaaggtcgagcatgggtgcagcccatgattttt
aatggagaatcattcaatgagtttcatgctcctcgtgaggtctgcgtgtcatcggtggtt
gatccggtagacgcaactttttgtgagccagttgagagagccaactcaagtcattctttt
acatctggtctggcggacactttgggtttgaggaatcaaccactgcgagtctacagcatg
gccaaatacgcagccgttgctcgaggggatgcagaaatcttcatgaagtttgcaaaagct
gggtacaaagagaaaatttgggatcatgcagcgggtgtgctcatagtccaagaagcgggc
ggtgtggtaactgacgcaggtggccgacctcttgacttctccaagggtcggtttctggaa
ggactggatcgtggcattgtagcttgctgtggaaagtccttgcacaacaaaatcattgca
gctgtggatgctagttacaattcgtctactctttga

DBGET integrated database retrieval system