KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_166483Help
Entry
PHYPADRAFT_166483 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    PHYPADRAFT_166483
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PHYPADRAFT_166483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 258 aa AA seqDB search
MEEAAGDEEWYTIALWGYFAMAAIMFVLVNFCLSAPYGRHVRRGWGFSVPVREGWIIMES
PALFVMALVYHAGQFHLQHVPHVLLRMHQMHYFHRTLVFPFRMRADGKAMPAAVVASGFF
FNVYNSYIQARWISHIGVYPSSWLTSPQFLLGVAIFLVGFLGNIWADNVLLNLRDHKEDR
SYKIPRGFLYEFITCPNYFCEIIEWLGWAIATNSVAGFFFFLSTLANLGPRAKTHHEWYH
KKFNDYPRNRKALIPFLY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggccgcgggcgatgaggagtggtacacgatcgcgctgtggggttatttcgcc
atggctgcgatcatgttcgttctagtgaatttctgcttgtctgcgccatacgggcgccat
gtgcggaggggctggggtttcagcgtgccggtgcgagagggttggattatcatggaatcg
ccagctttgttcgttatggcacttgtctaccacgcgggccaatttcacttgcagcatgtt
ccccatgtcctcctaagaatgcatcaaatgcattacttccaccgaacgcttgtatttccc
ttccgcatgcgagccgatgggaaggccatgccagccgccgtagtggcctcaggatttttt
ttcaatgtatacaattcatacattcaagcacggtggatatcccacattggagtttaccct
tcctcgtggctgacaagcccacaattcttgctgggcgtcgcgatcttcctggtaggattt
ttgggtaatatctgggctgacaatgtgttgctgaatctgagggaccacaaggaagaccgg
tcatacaagattccaagagggtttctgtacgagttcatcacatgtcccaactatttttgc
gagataatcgagtggcttggctgggcgatcgcgacgaactcggttgctgggttcttcttc
tttctgtccactcttgcaaatctaggaccccgtgcgaagacccatcacgagtggtatcat
aagaagttcaatgattatcccaggaatcgcaaggctcttatacccttcttgtactga

DBGET integrated database retrieval system