KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_167171Help
Entry
PHYPADRAFT_167171 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PHYPADRAFT_167171
Protein kinases [BR:ppp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PHYPADRAFT_167171
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PHYPADRAFT_167171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 368 aa AA seqDB search
MATKVEVPEGTCPPGKHHYMLWRSVFEIDTKYVPMKPIGKGAYGVVCSAKNNEAGDRVAI
KKITNAFENTTDARRTLREIRLLRHLFHENIIAVKDIMKPVGRRTFNDVYIVYELMDTDL
HQIIRSSQTLTDDHCQYFIYQLLRGLKYIHSANVLHRDLKPSNLLLNASCDLKICDFGLA
RTGSDKGQFMTEYVVTRWYRAPELLLSCDEYTSAIDMWSVGCIFAELLGRKPLFPGKDYI
HQLKLIISIIGSPDETDLHFIQSHKARSYIQSLPFTPRVSLARLYPRANPLAIQLIDRML
VFDPRKRVTVHEALEHPYLSMLYDASQELSAPAPFDFDFEDEDLKEDALRERVWNEMLMY
HPEAASEM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaaagtggaagtccctgagggcacatgtcctcctggtaaacaccactacatg
ctatggcgaagtgtatttgagattgacacgaagtatgtcccgatgaagccgattgggaag
ggagcatacggtgtagtgtgttcagccaaaaacaacgaagcaggggatcgagtggctatc
aagaagatcacgaatgcatttgagaatactacagacgcccggcgtacgttgcgtgaaatc
cgtttgctgcgtcatttgttccacgagaacataattgccgtgaaggatatcatgaagcca
gttggtcgtcgaactttcaacgatgtttacattgtgtatgagcttatggacaccgacctt
catcagataatccgttcgtcacagacccttacggatgaccattgccagtattttatttac
cagttgttgcgaggtctcaaatatatccattctgcgaatgttctgcaccgcgatctaaag
ccaagtaatctgctactcaatgctagctgcgacttaaagatttgcgacttcggattggcg
cggacagggagtgataagggtcaattcatgaccgagtacgtcgtgacgaggtggtacagg
gctcccgagcttcttctgtcatgcgatgagtacacaagcgcgatagatatgtggtctgtt
ggctgcatatttgcggagcttttggggcggaagcccttatttcctggcaaggattatatt
catcagctcaagctgataataagcatcatcggatctccggacgagactgacctgcatttt
attcaaagtcataaggcgcggagctacatccaatccctccctttcacgcctcgtgtatct
ctcgctcgcctttatccccgcgcaaatcccttggccattcagttgatagataggatgctt
gtgtttgatccgaggaagcgggtcaccgtgcacgaagctctggagcacccatacttgtca
atgctatacgatgctagccaggagctctccgctcccgctccttttgacttcgactttgag
gatgaagacctcaaggaggatgcattgcgagaaagggtttggaacgaaatgttgatgtac
cacccagaagcggccagtgagatgtga

DBGET integrated database retrieval system