KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_167171Help
Entry
PHYPADRAFT_167171 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 368 aa AA seqDB search
MATKVEVPEGTCPPGKHHYMLWRSVFEIDTKYVPMKPIGKGAYGVVCSAKNNEAGDRVAI
KKITNAFENTTDARRTLREIRLLRHLFHENIIAVKDIMKPVGRRTFNDVYIVYELMDTDL
HQIIRSSQTLTDDHCQYFIYQLLRGLKYIHSANVLHRDLKPSNLLLNASCDLKICDFGLA
RTGSDKGQFMTEYVVTRWYRAPELLLSCDEYTSAIDMWSVGCIFAELLGRKPLFPGKDYI
HQLKLIISIIGSPDETDLHFIQSHKARSYIQSLPFTPRVSLARLYPRANPLAIQLIDRML
VFDPRKRVTVHEALEHPYLSMLYDASQELSAPAPFDFDFEDEDLKEDALRERVWNEMLMY
HPEAASEM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaaagtggaagtccctgagggcacatgtcctcctggtaaacaccactacatg
ctatggcgaagtgtatttgagattgacacgaagtatgtcccgatgaagccgattgggaag
ggagcatacggtgtagtgtgttcagccaaaaacaacgaagcaggggatcgagtggctatc
aagaagatcacgaatgcatttgagaatactacagacgcccggcgtacgttgcgtgaaatc
cgtttgctgcgtcatttgttccacgagaacataattgccgtgaaggatatcatgaagcca
gttggtcgtcgaactttcaacgatgtttacattgtgtatgagcttatggacaccgacctt
catcagataatccgttcgtcacagacccttacggatgaccattgccagtattttatttac
cagttgttgcgaggtctcaaatatatccattctgcgaatgttctgcaccgcgatctaaag
ccaagtaatctgctactcaatgctagctgcgacttaaagatttgcgacttcggattggcg
cggacagggagtgataagggtcaattcatgaccgagtacgtcgtgacgaggtggtacagg
gctcccgagcttcttctgtcatgcgatgagtacacaagcgcgatagatatgtggtctgtt
ggctgcatatttgcggagcttttggggcggaagcccttatttcctggcaaggattatatt
catcagctcaagctgataataagcatcatcggatctccggacgagactgacctgcatttt
attcaaagtcataaggcgcggagctacatccaatccctccctttcacgcctcgtgtatct
ctcgctcgcctttatccccgcgcaaatcccttggccattcagttgatagataggatgctt
gtgtttgatccgaggaagcgggtcaccgtgcacgaagctctggagcacccatacttgtca
atgctatacgatgctagccaggagctctccgctcccgctccttttgacttcgactttgag
gatgaagacctcaaggaggatgcattgcgagaaagggtttggaacgaaatgttgatgtac
cacccagaagcggccagtgagatgtga

DBGET integrated database retrieval system