KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_169354Help
Entry
PHYPADRAFT_169354 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHYPADRAFT_169354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 523 aa AA seqDB search
MAKESKVVRAKPEEPVFSDDRSKRRKLTEDHNFCNADEAITLHLVKTEKDYLQGGNEDLS
FPPEFTEQFFGEEGRIYGYTGLKVEVFIHTVSFYTHYHLTFDSIAKDGGARNPKTNLRAK
LKEIFGESLIDNRDAFIEKIKQSTDSFVQVIKEEGTAVDSWRAPTGRNPSDVSRMANGKL
RQVVRLELTDPRVRKWYTCLTPLIHLFVEGGQPIESDDPRWEMYVTLEGEGPDIIVTGFC
TVYRFFRYPDSTRLRIAQILVLPPYQGQGYGHRLLETINRIAVERDCYDITFEDPSDSLQ
ELRDCMDVQRLLQFPPAVSALSLSIARLRRMAGGGGETATTSGLDPKSNTFTKGKKRNSD
VDTDDNILVPPASVVEEARKAFKITKVQVKRCWESLLFLQLASSETGVVESFRELLIKRL
HAGIFSNKDEAVGHGKHIIDTKNDYNINKTFMMMRTPQKETNGHDSKKIGDVLDASDEEK
KLQALQELLEERENELQAVANKVSARCKKLGIAVKVKDLVNQA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggagagcaaggtcgtgcgcgcgaagccggaggagcccgtcttctccgatgac
cgaagcaagcgccgcaagttgactgaggatcacaatttctgcaatgctgacgaagcaatt
acgctgcatcttgttaaaactgaaaaagattatcttcaagggggtaatgaggatctatcg
tttccaccggagttcacggaacagttttttggtgaagaaggaagaatatatggatatact
ggtctgaaggttgaagtttttatacacactgtctccttctatactcattatcaccttacc
ttcgattcgatagctaaggatggtggagctagaaatcctaagacaaatcttcgtgcaaaa
ctgaaggagatttttggtgagtcactgattgacaatcgggatgcgttcatcgaaaagata
aagcagtctactgattcctttgtgcaagtaatcaaagaggagggaactgctgtggattcc
tggagggcacctacagggagaaatccatccgatgtctcaaggatggcaaatggaaaatta
cgacaggttgtgcgattagagcttacggacccccgagttaggaagtggtacacttgtctg
acgcctctgatacatctatttgttgagggtggtcagcccattgaaagtgatgatcctagg
tgggaaatgtatgtgacacttgaaggagaaggcccagatattatagttactgggttttgc
acggtctatcgctttttccggtaccctgacagcacgaggttgaggattgcacagattctg
gtactacccccttatcaaggacaaggatatggacatcggttgctggagactatcaacaga
atagcagtggagcgcgactgctatgatataaccttcgaggatccttcagatagcttgcaa
gagctgcgcgactgcatggatgtgcagcggcttctgcagtttcctcctgctgtctcggcg
ctctccttgtctatagcaagattgcgtaggatggctggaggtgggggcgagactgcaacg
acgtcaggactggacccgaaatcgaataccttcaccaagggtaagaaaagaaactcagat
gttgataccgatgacaacatcttggtacctcctgcatcggttgtagaggaagccaggaag
gctttcaaaatcaccaaggtacaagtgaaaaggtgctgggagtctctactattcctgcag
ttggcatcatcagagacgggtgtagtagaatcgttcagagagctcctcataaagcgtctc
cacgctggtatattttccaacaaagatgaggcagtaggacatgggaagcacatcattgac
acgaagaatgactacaacatcaataaaactttcatgatgatgcgtactccacaaaaggag
acgaacggccacgactccaaaaagataggtgatgttctggatgccagtgatgaagagaaa
aaattacaagcccttcaagagcttttagaggaacgagaaaatgagctgcaagctgtggcc
aacaaggtatctgcgaggtgtaaaaaacttggcatcgcagtgaaggtcaaggatttagtt
aaccaagcatga

DBGET integrated database retrieval system