KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_171263Help
Entry
PHYPADRAFT_171263 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PHYPADRAFT_171263
   00052 Galactose metabolism
    PHYPADRAFT_171263
   00500 Starch and sucrose metabolism
    PHYPADRAFT_171263
   00520 Amino sugar and nucleotide sugar metabolism
    PHYPADRAFT_171263
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PHYPADRAFT_171263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 516 aa AA seqDB search
MLHVGAISELQHNEALPVRVRVTKQLCDTRKILMRDLAYIRKSAVPAVESPASTEVDQLT
RIRLELATLDQISDNEKQGFLKLIGRYLGGKSEAIQWEKIKPPTDEVVVPYDKMSEFSDD
PVKIKSLLDKLAVLKLNGGLGTTMGCTGPKSVIEVRNGLTFLDLIVKQIESLNQTYDSNV
PLVLMNSFNTHDDTLKIVERYKDSKLEVITFNQSQYPRVVAADMIPWPAKGKTDNAGWYP
PGHGDVFPSLDNSGKLDELLAQGKEYVFIANSDNLGAIVDLKILNHLVENQNEYCMEVTP
KTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIDKFKIFNTNNMWVNLKAIKRLVE
ADALQMEIIPNPKEVDGVKVLQLETAAGAAIRFFDRAIGVNVPRSRFLPVKATSDLLLVQ
SDLYTVQDGAVVRNPARTNPENPSIDLSSEFKKVGDFLKRFKSIPSILELESLKVSGNVW
FGKDIVLKGKVVVEAAKGEKVEVPDEAVLDNTVVKN
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctccacgtgggtgcaatttctgagttgcagcacaatgaagcgttacctgtgcgcgtc
agggtaacaaaacaactgtgtgatacccgtaagatactgatgagagacctagcatatatc
cggaagagtgctgtgccggccgttgaatcccctgcctctaccgaagtcgaccagctcacc
cgtattcgcctcgagttggccacactcgaccagatcagcgacaatgagaagcaaggtttt
ctcaagttgattggacgctacttgggtggaaagagtgaagccatccagtgggagaagatc
aagcccccaactgatgaagtcgttgttccctacgacaaaatgtctgagttctctgatgat
ccagtcaagatcaagagtcttctcgataagcttgcagttctcaagctaaatggtggtctc
ggaaccacaatgggctgcactggtccaaagtcagtcattgaggtccgcaacggcttgact
tttttggatttgatcgtgaaacaaattgagagcctcaatcagacttatgactccaatgta
cctcttgttttgatgaactcgttcaacacacacgatgataccttgaagatcgtggagaga
tacaaagattcaaagctggaagtcatcactttcaaccagagtcaataccctcgcgttgtt
gcagcggatatgattccatggcctgccaagggcaagaccgataacgctggctggtaccca
cccggccatggtgacgtgttcccttcacttgataacagcggaaagctcgatgagcttctt
gcccaggggaaggagtacgtgttcattgccaattccgacaatttgggagcgattgtcgat
ctcaaaatcttgaatcatctggtcgaaaaccagaacgagtattgcatggaggttacaccg
aagacccttgctgatgtgaagggaggaaccttgatttcttacgaaggcagggtgcagctt
ctggaaattgctcaggttcctgacgagcatgtcaacgaattcaagtctattgacaaattc
aagatctttaacaccaataatatgtgggttaatctcaaggccatcaaaaggcttgtcgaa
gctgatgctttgcaaatggagattattccaaacccaaaggaagtggatggtgtcaaggtc
ctacaactggaaactgctgctggagccgccattcgcttctttgatagggctattggagtg
aacgttccgagatctcgtttccttcccgtcaaggctacctcagatttgctgttggttcag
tcggacctctacacagttcaagatggtgcagtggtacggaaccctgccagaaccaacccc
gaaaacccctccattgatctcagtagcgaattcaaaaaggtgggtgatttcttgaagcgt
ttcaaatcaattcccagcatccttgaattggagagcttgaaggttagcggaaacgtatgg
ttcggcaaagacattgtcctcaagggtaaagtggttgttgaagcagctaagggagagaaa
gtggaagtgcctgacgaagctgttcttgataacacggtcgttaagaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system