KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_172074Help
Entry
PHYPADRAFT_172074 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 132 aa AA seqDB search
MSWQSYIDDHLMYEISPGHSLAAAAIIGHNGSVWAQSENFPQLSPEEVDKLLNGFEENSP
LAQNGLFLGGSKYMVLQGDPGIVIRGKKGPGGCTIRKTNSAFVIGIYDEPCTPGECNIAV
EKLGEYLFEQGL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaatcatacattgacgatcacttgatgtacgagatttctcctggccattcg
ctggcagctgctgccatcattggccataatggaagtgtttgggctcagagcgagaacttc
ccccagttgagccctgaggaggtggacaaacttctgaatggatttgaggagaacagtcct
ctggcccagaatgggctctttctgggaggatccaagtacatggttctgcaaggtgaccca
ggcattgtcattcgcggaaagaagggtcctggaggttgcacgataaggaagacgaacagc
gcatttgttattgggatatatgatgaaccttgcacccctggtgaatgcaacattgccgtg
gagaagcttggtgaatacctgtttgaacaaggactttga

DBGET integrated database retrieval system