KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_173106Help
Entry
PHYPADRAFT_173106 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHYPADRAFT_173106
Enzymes [BR:ppp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PHYPADRAFT_173106
Peptidases [BR:ppp01002]
 Cysteine Peptidases
  Family C44
   PHYPADRAFT_173106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 581 aa AA seqDB search
MCGILAILGSHDASPARRDRILELSRRLRHRGPDWSGLFAGQKCWCYLAHERLAIIDPAS
GDQPLYNENKDIVVAANGEIYNHEALKKSMKPHKYHTQSDCEVIAHLFEDVGEDVVNMLD
GMFSFVLVDNRDNSFIAARDPIGITPLYYGWGADGSVWFASEMKALKDDCERFEIFPPGH
IYSSKAGGLRRYYNPAWFSETFVPSTPYQSLVLRAAFEKAVIKRLMTDVPFGVLLSGGLD
SSLVAAVASRHIAGTKAANIWGKQLHSFCVGLQGSPDLKAAREVANYIGTQHHEFHFTVQ
EGLDALSDVIYHVETYDVTTIRASTPMFLMTRKIKALGVKMVLSGEGSDEIFGGYLYFHK
APNREEFHHELVRKIKALHMYDCQRANKSTSAWGLEARVPFLDKEFMEVAMAIDPAEKLI
RKDQGRIEKWVLRKAFYDEKNPYLPKHILYRQKEQFSDGVGYSWIDGLKAHAQSHVSDQM
LKHAKHVYPYNTPQTKEAYYYRMLFEKHFPQQSARLTVPGGASVACSTATAVAWDKSWAG
NLDPSGRAALGCHDAAYTENSAAMSYITKNMSNVGQKMTIH
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattttggctattctcggttcccacgacgcgtcgcctgcgcgacgtgatcgc
attctggagctttcccgcaggctgcgccaccgcggtcccgactggagtgggctgttcgca
gggcagaagtgctggtgttatctggctcatgagcgcttggccatcattgatcccgcctcg
ggcgaccaacctctgtacaatgagaacaaagatatcgtcgtcgctgccaatggagaaatc
tacaaccacgaggccttgaagaagagcatgaagcctcacaagtatcacacgcagtccgac
tgtgaagttattgctcatctctttgaagatgtcggcgaggacgtggtcaacatgctggac
ggcatgttctcattcgtgttggtcgacaaccgcgataattccttcatcgccgcccgggat
cccattggcatcacccctctctactacggctggggtgcggatggaagtgtttggtttgca
tcggagatgaaggccttgaaggacgattgcgagcggttcgagattttcccacccggtcac
atctactctagcaaagctggagggcttcggcgatattacaacccagcttggttctctgag
acttttgtccccagcaccccttaccagtctcttgttctccgcgcagccttcgagaaggct
gtaatcaagagactgatgaccgacgtgcccttcggtgtactcctatccggagggctggat
tcttcattagtggcagcagtggcatcccgtcatatcgcaggaactaaagctgccaacatc
tggggcaagcagcttcactctttctgcgtcggacttcagggttctcctgacctgaaggct
gctcgggaagtcgccaactacatcggcacccagcaccacgagttccactttactgtccaa
gaaggtttggacgctctgtcggatgtgatctatcatgtggagacttacgacgtgaccacc
atccgagctagcacgcccatgttcctcatgacacgcaagattaaggctctgggtgtaaag
atggtgttgtctggggagggatccgatgaaatttttggtggttacctctatttccataaa
gcgcccaacagggaggagttccaccatgagcttgttcgcaagatcaaggcgctgcatatg
tatgattgccagagagccaataagtcgacgtctgcctggggtttggaggcgcgtgttccc
ttcctagacaaagaatttatggaagttgccatggctatcgatcctgcggaaaagctgatc
aggaaggaccaaggaagaatagagaagtgggtgctccgaaaagctttctacgacgaaaag
aatccttacctgcccaagcacattttgtatcgccagaaggagcaattcagcgatggcgtt
ggctacagctggattgacggcctcaaggctcatgcacagagccatgtatccgaccaaatg
ctgaagcatgcaaagcacgtgtacccctacaacacgccgcagactaaagaagcatactat
taccgaatgctcttcgagaaacacttcccgcagcaatccgctcgcttgacggtccccgga
ggtgctagcgtcgcatgtagcacggccacagcagttgcatgggacaagtcctgggcgggc
aacctggacccatctggccgagcagcattgggatgccacgacgcggcctacacggaaaac
agcgctgcaatgagttacataacaaaaaacatgtcaaatgttggacaaaaaatgaccata
cattga

DBGET integrated database retrieval system