KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_173356Help
Entry
PHYPADRAFT_173356 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Protein kinases [BR:ppp01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PHYPADRAFT_173356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2979 aa AA seqDB search
MATATNLHTIFHNVLHKVELSFEVLSQMPIEEETFRSVKFHGDLKKLLATLKEKDFTPPL
AKLQEMKKKRTDLKRRRRRRRRILKESCHEGETPRSRPPMLTAHSTHSEAGLPACLARHP
NPQENQCDGDGRTDGRMPKNEQTNERAINGASSTTTTTNASDRWLSRGRSIRINPCRARV
SGDHVAVVAYSNSTPVGSTAGGGGEGGAWQPGKGKGKGRAAPGLGGEFLRRRPPLHPSTP
LYPGSAVLWSAGGEQSSRPFRVGEEEELEEKEHGRRRLRPRLDIKEEEQEQEDEEEEGGE
RKKKGGERKKKGGERKEKGGGGGEGGLGRGGGAAADGGYGDDGGICNGVFHVEGTVGMGP
HRAPDSLRRLLEGSSQNLAKHVEEEARDLGGEAFTRFMDNLYDKIQTLAESDEVRDNLAC
VRAIRELIDLQLGEIATKIAKFASNLRHIFEHKTDSEVLVNASRALGHLAATGGALTADV
VEYQLQKLDDSSTLLSYLNPNHSAHCTNLLNKRLATLDAYVKVERRVTYTCLQVKKSLEW
LQEPRVENHRFAAVLILKACNFTCSALSFFPGSAWLAHLEMAENAPTVFNVHVSDFIEAV
WVALRDPKMQVREAAVKALRACLCVIEKRETRWRVQWYYRMFERTQDGLGPSASVESIHG
SLLAVGELLRNTGEFMMSRYKEVASFVLKYREIRNPLVRQSITALLPRIAHFLRDRFVSS
YLKICMDHLLNVMRKADERESGFHALAEMASAVGKELKEYLPIIMSILKDAINPPRRGRP
SLEAVACVGALADAIGPDMKPYVEGLLDSMFALGLTPTLVHALKQISSRIDSLLPVIQER
LLDSISFVLAKTPYRTTRGVTPVVRPLKNAWMPSTMDISGPALTQLALNTLTNFDLRGHE
LLEFAREAVIVYLEDDDAATRREAAECCSHLVEHSSKIVELIAITPVVVNTRSGRTTGVG
IRRRRLLIEEILEKLLVAAVADPDVGVRKTVFLSLHKYHSFDEYLAQADSLRAIFIALTD
EAYEVRELTITMAGRLADHNPAYVLPALRRHLVQLLTDLRHSADSKSREESAKLLGCLIK
ACERLMGPYIDPVLRTLLEKLQEGSVGTGNNGVIAGVLATVGDLAKVGGCTLRRYMPDLM
RPIVEALMDGTSFSKREVAVATLGKVVESTGYVVRPYTEFPHLLGLLLRLLNSDLSDSAR
REVLKVLGIIGALDPHQHKRNQQFLPGPHGEGARVNGAESGTHNAQSLEEVPVELLQSGG
LLTTNEDYFPTVAIKALLRVLRDPTLSSYHHRVVGSLMYILKSMGLSCVPYLPKVLPELF
FTIRNCEDVLREFSFWQLASLVSIVRQHIRKYLGEILKLVHEYWNLLMLPLSPRTGPSML
HTNAKAGNISPVLNLVEQLSLALNDEFRGYLPEFLRLCVTVLTDAERTGDYKKVPPVLHT
FEVLGGSVDEHMYLILPALVRLFRPDVSNAPLEIRRAAIKTLGRLLPCVQVSGLVSSVLL
PLTRVLDGSINELRKDAVDTICALAVAMGADFAYYVPSVRKPMLRHHHPQFDALETRLNR
REPAYMDVHSTPPATVPPVVAYGSIPSSPSFHNLNWDGEVCDGENFDSSGNSRPLTVNEG
ALRIAWESSQRSTKEDWTEWMRHFSVELLKESPSRPLRTCAGLAQLQPFVARELFAAGFV
SCWSQLNLQHQEQLVRSLVIAFSSPNIPPEILASLLNLAEFMEHDEKPLPIDIRTLGQLA
EKCHAYAKALHYKEMEFEGAQSMDSDAIQALTVETQPQPVSAVEALIHINNQLNQHEAAM
GILTYARKHLRVDLKESWYEKLQHWELALEAYKKKALQCQSNPDELQSATLGLYLGASLA
RWEELSILCRDSWNPVEVSRCHEMAPMAASAAWNMGNWKEMEKYVTLLEDGTNTQVHLPT
LNTSGSGNGASDGAFFKAVLCVRRSVDAKRQSDAVDPNSPRYRELIAGFNREINESMQEA
SQCVQKARNCLATELAALVLESYDRAYSNMVRVQQLSELEEVMEYLSLPSPKEPRADLIR
KMWRDRMHGTKRKVEVWQSLLAVRTLVLPRTEDTETWLKFASLCRKSGRDRQARSTLVKL
LQYDPETSPPDDLPFASAPQVMLAYYKYQWSLGDETQRRDAFLRLQEIAADLTEQNVAEV
SGLFMPNASSDVSSTVGGVPLLARVHLKLGAWRWHLNPSLDDETVRGILKDLSSATQYAS
KWAKAWHKWALFNTALIVSYTSRGQHAAAGRHVVLAISAYFRSIANGAADNGRDGCLQDI
LRLLTLWFYHGASRDVQDALQKGFDLVPVETWLAVLPQIIARIHSNTPAVRTLIQQLLVR
IGRSHPQALMYPLLVACKSISTLRQKSAQYVVDQVRHHSGTLVEQAQLVSKELIRVAILW
HEMWHEALEEASRLYFGERNVDAMFNCLQPLHALLEREGPVTVKEQQFVQNYGRELAEAN
ECCTKYKRTGKEAELTQAWDLYYHVFKRINKQLPSLTTLELQTVSPELLEARNLELAVPG
TYRAAAPLVKIAGFSHQLVVITSKQRPRRLTIQGDNGKNYDFLLKGHEDLRQDERVMQLF
GLVNTLLGNSRLTAEKDLSIQRYDVIPLSPNSGLIGWVPNCDTLHHLIREYRDARKVLVN
AEHRTMLGFAPDYERLTLMAKVEVFEHALDNSLGNDLAKVLWLKSRSSEVWLDRRTNYTR
SLAVMSMVGYLLGLGDRHPSNLMLDRHSGKILHIDFGDCFEASMNREKFPEKVPFRLTRM
LVKAMEVSGIEGNFRSTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFTLPEPPHITG
QGRAGGHGNTEEGNRTSNIPSPPQRGARERELLQALGQLGDANEVLNERAVAVMARMSNK
LTGHDFMPTSTASHLLEPRGDGRELEPGLSVKTQVQKLITQAMSHENLCQSYVGLQKFGY
TVLSVTLFGPECTLHGRLNGALRMSPTSEAHTSTLCRDA
NT seq 8940 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcaaccaatctccacactattttccataatgtgcttcacaaagtagaactc
tcatttgaggtgttgtcccagatgccaattgaagaagaaacattcagatccgtaaagttt
catggagacctcaaaaagttattagcaacattaaaagaaaaagatttcacaccaccactt
gcaaagttacaggaaatgaaaaagaaaaggactgacttaaagagaaggagaaggaggaga
agaagaatcttgaaggagagctgccatgaaggagagaccccacgttctcgaccccccatg
ctcacagcgcactcaactcactccgaggctggcctgcctgcctgcctggctcggcatcca
aacccccaagaaaaccagtgcgacggggacggacgaacagacggacggatgccaaagaac
gaacaaacgaacgaacgagccatcaacggagcctcatcgacgacgacgacgacaaatgct
agtgatcgttggctgtcgcgggggcgcagcattcgaatcaacccgtgccgagcacgggtc
agcggcgaccatgtagccgtggtggcctatagcaactctacacccgtgggctcgactgcg
gggggcgggggtgaggggggtgcatggcagccgggcaagggcaagggcaaagggcgcgcc
gcgccggggttggggggtgagttccttcgtcgtcgtcctccactccacccttctacccct
ctctaccccggtagtgcagtgctgtggagcgcagggggtgagcagagcagtcgtccattt
cgggtcggggaggaggaggagttggaagagaaggagcacggaagacgacgactgcgacca
agactagacatcaaagaggaggagcaggagcaggaggacgaggaggaggagggaggagag
aggaagaagaagggaggagagaggaagaagaagggaggagagaggaaggagaagggagga
ggaggaggagaaggtggactcggaagaggaggtggagctgctgcagatggtggctatggc
gacgacgggggaatttgcaatggcgtgtttcatgtagaggggacagtgggaatgggcccc
catagagcgccggactcgctgcgccgcttgctggaaggatcttcacaaaatctggcgaag
catgtggaagaggaggcgcgggacttgggtggggaggccttcacacggtttatggataat
ctgtatgataagattcaaactctagcggagagtgatgaagttagggataatctggcatgt
gttcgtgccatacgcgaactcatagatttgcagcttggagaaattgccacgaaaattgca
aaattcgccagcaacctgcggcatattttcgagcacaagacggacagcgaggttctggtc
aatgctagcagggcactcggccacttggctgctactggcggtgctcttactgctgatgtt
gttgaataccagctgcagaagttagacgatagttccaccctattatcatatttgaatccg
aatcattccgctcattgcacaaacctgctgaataagaggcttgcgacgctcgatgcctat
gtgaaggtggagcgaagggtgacatacacttgtcttcaggtcaagaaatctttggagtgg
cttcaagaaccgcgtgtggagaatcatcgttttgctgctgttctaattttgaaggcatgt
aacttcacctgttctgctcttagtttcttcccaggttctgcatggttagctcatctggaa
atggcagagaatgccccgacagtgttcaatgtgcatgtctcggactttatagaggccgtt
tgggtggctttaagggatccaaaaatgcaagtccgagaggctgctgttaaggccttgaga
gcctgtctttgtgttattgaaaagcgtgagactcggtggcgcgttcaatggtattatcgc
atgtttgaaagaacccaagatggacttggtccaagtgcaagtgtggagagtattcatggt
tctttgcttgcagttggggagttgctacggaacactggagaattcatgatgtctcgctac
aaagaagtagctagtttcgtgctcaagtaccgtgaaatccgcaatccattagtgcgacag
agcatcactgcattgttgccaaggatagctcactttcttcgtgatcgctttgtgtcatct
tatcttaagatatgtatggatcatttgttgaatgtcatgcgtaaagctgatgagcgtgaa
agtgggtttcacgcattggctgaaatggctagtgctgttggcaaggagttgaaagaatac
ctgcctattattatgagcattttgaaggatgcgataaatcctcctcgtcgtggacggcct
tccctagaggcagtagcctgcgttggtgctcttgcagatgccattggaccagacatgaag
ccttatgttgagggtttacttgattccatgtttgctttgggtcttactcctactcttgtg
catgctttgaagcagatatcttccaggatagattccttgttaccagtgattcaagaaaga
cttcttgactctatttcatttgtattggccaaaacgccgtatcggacaacacgaggagtt
actcctgttgtgcggcccttgaaaaatgcatggatgccttctactatggacatttcggga
cccgctttaactcagctcgcactgaacactctaactaacttcgatcttcggggtcatgaa
cttttggaatttgcgagagaggcggttattgtgtacttggaggatgatgatgcagctact
aggagagaggctgctgagtgttgttctcaccttgtggaacactcttctaagattgttgaa
cttattgccattacacctgtagttgtaaatactcgcagtggtcgcaccacaggtgtaggg
atacgccgccgacgacttcttattgaagagattctcgagaagctgttagtagcagctgtg
gcagatcctgatgtgggtgtaaggaaaacagtgtttttgtctttacacaaataccacagt
tttgacgagtatctcgcccaggcagacagccttcgggcaatcttcattgcccttacagac
gaggcttatgaagtgcgggagctcactataaccatggctggtcgtttggctgaccataat
ccagcatatgtacttccagcattgcgtcgacatcttgttcagctcctgacagatcttcga
cacagtgctgacagcaagagtagagaagaaagcgcaaagctgcttggctgcttaatcaag
gcttgtgaacggcttatgggtccctacatagatccggttctgcggaccctattggaaaag
ttacaggaaggttctgttggaactggaaataacggtgtcattgctggggtcctcgcaact
gtcggggatcttgccaaagtgggtggttgtacgttgagacgttatatgcctgatctaatg
cgtccaatagtcgaagcacttatggacggtacatcattcagcaagcgtgaagttgcagtg
gcaaccttgggtaaagttgttgaaagcactggatatgttgtgcgtccttacacggagttt
ccacacttgctgggtctacttttgagattactcaacagtgatctttcagattcagcccgt
agagaagtgctcaaagttttagggataataggtgctcttgatcctcatcaacacaaacga
aatcagcagttccttccaggtccacatggagaaggagctcgggttaatggagctgaaagc
ggaactcataatgctcaatccctggaggaggtgcctgtcgagcttcttcaatctgggggt
cttttaaccacaaatgaagactactttcctacagtggccatcaaagctctgctgcgagtt
cttagggatcccactttgtccagttaccatcacagggtagtaggttccttaatgtacata
ttgaagtcaatgggacttagctgtgttccctatcttcccaaggtccttcctgaactcttt
tttactatacgaaattgcgaagatgtcctcagagaattcagtttctggcaacttgcttct
ttagtcagcattgtacgccagcatattagaaaatatcttggtgagattctcaagctagtg
catgaatattggaacctgttgatgctccctctttcaccgagaacgggtccttcaatgcta
catacgaatgctaaggcaggcaatatttcaccggtgttgaatctagtggaacagcttagt
ttagcattaaatgatgaatttcggggatacttgccggagtttttacgcctttgtgttact
gttcttactgatgctgagcgcactggtgattacaagaaagtaccccctgttctacatact
tttgaagttcttggaggtagtgttgacgagcatatgtacttgatacttccagctcttgta
cgcttatttaggcctgatgtctcaaatgctcccttagaaatccggcgtgcagctatcaaa
actcttggtcgactgcttccttgtgtgcaggtgtctggactcgtatcatcagttttactc
cctttgaccagggttcttgacggaagcattaatgagttacgcaaggacgctgtggatact
atttgtgcattagcggtggcaatgggagctgattttgcttattatgtgccctctgtgcgg
aaacccatgttacgtcatcatcatccacagtttgatgctttggagactcgtttaaatcga
agggagcccgcatacatggatgtccattccactcctccggcgactgtaccacctgttgtt
gcgtacggaagtattccgtcgtcaccatcgttccacaatcttaattgggatggcgaagtc
tgtgatggggagaattttgattcttctggaaattcacgtcctctgacggtgaatgaaggg
gctttgagaatcgcatgggagtccagtcaaagaagcacgaaagaggactggacagaatgg
atgcgtcatttcagtgtggagcttcttaaagagtccccgtcacgcccactgcgaacctgt
gcaggccttgcccaattacaaccttttgtggcccgggaactgttcgcagcaggttttgtc
agctgttggtcacagcttaaccttcaacaccaggaacagctagtgaggagtctagtgatt
gcattctcttcgcctaacatacctcctgagattctggcgtctttgcttaatctggctgag
ttcatggagcatgacgaaaaaccacttccaattgacattcgaacacttggacaacttgca
gagaagtgtcatgcttacgctaaggctttgcactacaaggaaatggaatttgaaggagca
cagtctatggattctgacgcaatccaggccttgactgtggagacccagcctcagcctgtt
tcagcggttgaggccttgatccacattaacaatcaattgaaccaacatgaggctgccatg
gggatcttgacatatgcacggaagcacctgcgagttgatctcaaggagtcatggtatgaa
aagctgcaacactgggagttggccttggaggcttacaagaaaaaagctttacagtgccag
tctaacccggatgaactgcagtcagctacactaggtttgtatctcggtgcatcactggca
cgatgggaggagctgagcattctatgtcgagacagttggaaccctgttgaagtttctcgt
tgccacgaaatggcacctatggctgctagtgctgcgtggaacatgggaaactggaaggag
atggaaaagtatgttactcttttagaagatggaactaacacgcaggtccatttaccgact
ctgaatacaagcgggagcggcaatggagcaagtgacggtgccttcttcaaagctgttcta
tgtgttcgacgcagtgtcgacgcaaagcgtcaatcagatgcagtagatcccaactcccca
aggtacagggagttaattgctggatttaatagagaaatcaatgaatccatgcaagaagct
agtcaatgcgtgcaaaaagcacgtaattgtttggccaccgagcttgcagcgctggtctta
gaaagttatgacagggcgtacagcaacatggttcgggtgcaacaactttctgagcttgaa
gaagttatggagtacctctctttaccttcaccaaaagaacctcgtgctgatttgattcgg
aagatgtggcgggatcgcatgcatggcaccaagcggaaagttgaggtatggcaatcactt
ttggctgttcggacattggtgctcccacgaactgaagatacggaaacctggcttaaattt
gcttccttgtgtcgcaaaagcggccgagaccgccaagctcgatcaaccttggtgaaactt
cttcagtatgatcctgaaacaagcccacctgatgaccttccattcgcgagtgctccacaa
gtgatgttggcttactataagtatcagtggtctcttggggatgaaacacaaaggagagac
gcgttccttcggcttcaggaaatagcagcggatttgacagagcaaaacgtggctgaagta
agcgggttgtttatgccaaatgcatcctctgatgttagctcgactgttgggggtgtgcct
cttctagcgcgtgtacatctgaagttaggcgcatggcgttggcacctcaacccttcgtta
gacgatgagaccgtgcgagggattctgaaagacctgtcgtctgcaacacagtatgccagc
aaatgggcaaaggcatggcataaatgggctctctttaacacagcccttattgtctcctac
acttctcgaggtcaacatgctgctgctggtcgccatgtggttttggctattagtgcttac
tttcgatcaattgccaatggagccgcagacaatggccgagatggttgtcttcaggatata
ttgaggctgctcaccctctggttctaccatggtgcctcacgagatgtgcaagatgcactg
cagaagggttttgatttagtgccagttgagacatggttggctgtgcttcctcagataatt
gctcgtattcattccaatactcctgcggtccgcacacttattcagcaacttcttgttcgg
attggtcgaagtcacccacaggcgctgatgtatccactgctagtggcttgcaaatccatt
agtacacttaggcaaaagtctgctcaatatgttgttgatcaagtgcgtcatcacagtgga
acacttgttgagcaggcccagctggtctccaaagagctcatacgtgttgcaatactttgg
catgagatgtggcatgaagctcttgaagaagccagtcgcttatattttggggaaaggaat
gtggatgctatgttcaactgcctgcaacctttacatgctctactcgaacgcgaaggtcct
gtgacagttaaggaacaacaatttgttcagaactatggacgcgaacttgcagaggcaaac
gaatgttgtacgaagtacaagcggaccgggaaggaagcggaacttactcaggcctgggat
ctctattatcatgtattcaagcgcatcaataagcagcttcctagcttgacaacattagag
cttcagactgtgtcacccgagcttttagaagctcgaaatttggagctagctgttcctgga
acatatcgggctgctgcgcctcttgtcaagattgcggggttctcccaccaacttgttgtc
atcacttccaaacagcgtccgaggagattgaccatccagggcgacaacgggaaaaactac
gattttcttcttaaagggcatgaagacttgcgtcaagatgagcgcgtcatgcagttattt
gggctggtaaacacactgttggggaattcacgtcttactgcggagaaagacctatcaatt
cagcgttatgatgttatacccctttcacccaatagcggtcttattggctgggtaccgaat
tgtgacactcttcatcaccttatccgcgaatatcgtgatgctcgcaaggtccttgtgaac
gcggaacaccgaacaatgctggggtttgctcctgattatgaaaggctcacactcatggct
aaggttgaagtatttgagcatgctttggacaattcacttgggaatgacctggctaaggtt
ttatggctgaaaagcagaagttctgaggtctggcttgaccgtcggactaattacacccgc
agcttggctgtcatgagcatggttggatatttgcttggacttggagatagacatcctagc
aatctcatgttggaccgtcatagtgggaagatcctgcacattgattttggtgattgcttt
gaagcatctatgaatcgtgagaaatttccggagaaggtgccattcagacttactcgtatg
cttgtgaaagccatggaagtgagcggaatagaagggaatttccgatccacttgtgagaat
gtcatgcaagtgttgaggaccaacaaagatagtgtgatggcaatgatggaagcttttgtt
catgatcccttgattaattggcgactattcacattgcccgagccacctcacataactggt
cagggtcgagctggaggacatggaaatacagaggaagggaatagaacctctaatattcct
tctcccccacaacgcggtgcacgagagcgtgaattgcttcaggccttgggacagcttgga
gacgcaaatgaagtgctaaatgagcgagcggtggctgttatggcacgcatgagtaataaa
ttaactggtcatgatttcatgcccaccagcacagcctcacacttacttgagcccagaggc
gatggccgggaactggagcctggattgagtgtcaaaacccaggtgcagaagctgattact
caggccatgtctcatgagaatctttgccagagctatgtcgggctacaaaaatttggttac
accgtcttgtccgttacgttatttggtccagaatgtactctacatggccgccttaatgga
gctttgaggatgtcaccaacatctgaggcgcatacatctacgctgtgtcgtgatgcttga

DBGET integrated database retrieval system