KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_173375Help
Entry
PHYPADRAFT_173375 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHYPADRAFT_173375
Enzymes [BR:ppp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PHYPADRAFT_173375
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PHYPADRAFT_173375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 428 aa AA seqDB search
MAGVTMAAGCGVSQALSAGASHEGLRRIAPAFGTVVVPIPSRCKVSRRVKVEAIAEPIAK
STVRTIEECEADVVAGNAPAAPPVPAKPKAPEGTPRISPLVMPARPRRNRRSAALRAAFQ
ETTVSPANFILPLFVHEGEQNAPIGAMPGCQRLGWRHGLIDEVYKARDVGVNNVVLFPKV
PDALKSSTGDEAYNPDGLVPRCIRLLKDKFPDLVIYTDVALDPYSSDGHDGIVREDGVIM
NDETVHQLCKQAVAQAQAGADVVSPSDMMDGRVGAIRNALDLAGYHDVSIMAYTAKYASA
FYGPFREALDSNPRFGDKKTYQMNPANYREALIETRLDEAEGADILMVKPAMPYLDVIRL
LRDNTALPISAYQVSGEYSMIKAAAAAGMLDEKKAVLESLLSIRRAGADVILTYFAIPAA
QWLCAERI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgtgacgatggcagcgggttgtggggtgtcgcaggccctctctgccggtgcg
agtcatgaaggtttgcgacgcattgcccccgcatttggtaccgtggttgtgcccattcct
agccgttgtaaggtgtcgaggagggtgaaggtggaggcaattgctgaacctatagcgaag
agtactgtgcggactatcgaggagtgcgaggctgatgttgttgctggaaatgctcccgcg
gctcctcctgttcctgccaaacccaaggctccggagggtacacccagaatttctccattg
gtaatgcctgcgaggccacgaagaaatcgcagatctgcagctcttcgtgccgcttttcaa
gagaccacagtttctcctgcgaacttcattcttccactatttgtccatgaaggagaacag
aatgcaccgattggggcaatgccaggttgccagcgccttggatggcgtcatgggctcatt
gatgaggtgtacaaggcaagagatgttggtgttaacaacgttgttctctttcccaaagtt
cccgacgcgcttaagtcctcaactggagatgaggcttacaaccccgatgggctggttcca
cggtgcattcggttactcaaagacaaattccctgatttggtgatttacacagatgtggcg
ctagatccttactcttcagatggtcacgatggcatagttcgggaagacggagtgattatg
aacgacgagacagttcatcaactttgcaagcaggccgtagcacaggctcaagctggggca
gatgttgtcagccctagtgatatgatggatgggcgtgtaggtgccatccgaaatgccctc
gatttagcaggataccacgatgtttcaattatggcttatacagccaaatatgcaagtgcc
ttttacgggcccttcagagaagcactggactccaatccccgttttggtgacaagaagacg
tatcaaatgaaccccgcaaattaccgcgaggctctgatcgagacaaggttggacgaagct
gaaggtgctgacattctcatggttaagcctgccatgccctacctggacgtcatcaggctt
ttgcgcgacaacaccgcattgcctatctcagcctatcaggtctcaggagagtattctatg
atcaaagcagctgctgctgcaggcatgcttgatgagaagaaagcagtactggagtctttg
ttgtctataaggcgagctggtgcagatgtaatcctcacctactttgccattccagctgct
caatggctctgtgctgagcggatttga

DBGET integrated database retrieval system